Locus Search

Obtain a report of related syntenic regions in multiple species by locus identifier
You can choose e.g. AT1G25460, GRMZM2G000039 ppa005930m



Display range :

The locus ( AT4G22305 ) is not contained in any block.

Details for Arabidopsis Locus AT4G22305

Position : Chr4 ( 5`- 11789332 .. 11791191 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT4G22305

Protein [Map View]
MARTFILWLHGLGDSGPANEPIQTQFKSSELSNASWLFPSAPFNPVTCNNGAVMRSWFDVPELPFKVGSPIDESSVLEAV
KNVHAIIDQEIAEGTNPENVFICGLSQGGALTLASVLLYPKTLGGGAVLSGWVPFTSSIISQFPEEAKKTPILWSHGTDD
RMVLFEAGQAALPFLKEAGVTCEFKAYPGLGHSISNKELKYIESWIKRRLKGSSSTCLQLNCLKEMFH*

DNA
ATGGCTCGAACTTTCATCTTGTGGCTTCACGGGTTGGGAGATTCTGGACCTGCTAATGAACCCATCCAAACTCAATTCAA
ATCCTCGGAGTTAAGTAACGCTAGTTGGCTCTTCCCTTCTGCTCCATTCAATCCGGTTACCTGCAACAATGGTGCGGTGA
TGCGTTCTTGGTTTGACGTTCCTGAACTTCCTTTTAAAGTGGGCTCTCCAATTGATGAAAGCAGCGTGCTTGAAGCAGTT
AAGAATGTTCATGCCATTATAGACCAGGAGATTGCAGAAGGAACTAATCCAGAAAACGTGTTTATCTGTGGATTAAGCCA
AGGAGGAGCATTAACCTTGGCTAGTGTTCTGCTTTACCCAAAAACTCTTGGAGGAGGTGCCGTCCTAAGTGGATGGGTTC
CATTCACTTCTTCAATCATCAGTCAGTTTCCCGAAGAGGCTAAGAAGACACCAATCTTGTGGTCTCATGGCACTGATGAC
AGAATGGTACTCTTTGAAGCTGGTCAAGCTGCTCTTCCTTTTCTCAAAGAAGCCGGTGTTACCTGTGAATTCAAGGCATA
TCCTGGTCTCGGGCACTCGATCAGCAATAAGGAGCTGAAGTATATAGAGTCATGGATCAAGAGACGGTTGAAAGGTTCGT
CGTCTACTTGTCTCCAACTTAATTGTCTTAAAGAAATGTTCCACTGA