Locus Search

Obtain a report of related syntenic regions in multiple species by locus identifier
You can choose e.g. AT1G25460, GRMZM2G000039 ppa005930m



Display range :

The locus ( AT1G27150 ) is not contained in any block.

Details for Arabidopsis Locus AT1G27150

Position : Chr1 ( 5`- 9429047 .. 9432274 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G27150

Protein [Map View]
MEKTVRCVRWGYEVNTSSDACIDAINSYFQQVLSYGRKRKVILEAPLYDKDCVLGSILAAHFLSSSDPSRANSYVEAAAS
NLEQSTPYEKAVYEAVTYLISEDRDDDLAFEMHTKLLKRFPKDLASLKRAQLLSFYMGQPDPFLGLVQQVLPANQEESYI
HGLLAFPLLELGRMEEAAAASRKGYEINKEDAWAHHCLCHVLQHECRFKEAVEFMEALAGTWPSCSSFMYTHNWWHVALC
YLEGGSPMSKVEEIYDHHIWKELEKDDAVPPEVYLNALGLLIRLDVRDALDGFEDRLKNLAVRLTNQANWYLEWHLDILI
VWALAKVGETSRAHELLEGLKFRLSKKNKKKQQVMQKGIQLGEAVYEYARGNYEKALELLGSEFNAIGYKIVGASDEQID
VFNEMWCQLLLKTGQSSTAKEVIRERIKARDGIPFMWRLLEKSYSMEGNAEAESSARERAKKLESCYF*

DNA
ATGGAGAAAACAGTGAGATGTGTTCGGTGGGGTTATGAGGTTAATACCTCTTCTGATGCTTGCATCGACGCAATTAACTC
CTATTTTCAACAGGTTCTTAGTTATGGGAGGAAGAGGAAAGTGATTCTAGAAGCACCACTCTACGATAAAGATTGTGTTT
TGGGCAGCATTTTAGCTGCTCATTTCCTTTCTTCATCTGATCCTTCTAGAGCTAATTCCTATGTTGAAGCTGCGGCATCT
AATCTCGAACAATCTACACCTTATGAGAAAGCGGTTTACGAGGCTGTTACTTACCTAATCTCTGAGGATAGGGATGACGA
CTTGGCTTTTGAAATGCACACCAAGCTACTTAAAAGATTCCCAAAGGACTTGGCTTCTTTGAAAAGAGCGCAGCTTTTAA
GTTTCTACATGGGTCAACCTGATCCCTTCTTGGGTCTTGTTCAGCAGGTTCTACCTGCGAATCAAGAAGAAAGTTATATT
CATGGTTTACTTGCGTTCCCATTGTTAGAACTTGGTCGAATGGAAGAAGCTGCGGCAGCTTCCAGAAAAGGCTATGAGAT
AAACAAAGAAGACGCTTGGGCACATCACTGTTTGTGTCATGTTCTTCAACATGAATGTCGGTTTAAAGAAGCAGTGGAGT
TCATGGAAGCACTCGCAGGAACTTGGCCCTCTTGCTCATCCTTCATGTATACACACAATTGGTGGCATGTTGCTCTCTGT
TACTTAGAAGGAGGGTCCCCAATGAGTAAAGTAGAGGAGATTTATGATCATCACATCTGGAAAGAATTGGAGAAAGACGA
TGCTGTTCCTCCTGAAGTTTATCTCAATGCATTGGGCTTGTTGATACGTTTAGATGTAAGAGATGCTCTTGATGGTTTTG
AAGACCGTCTCAAAAACCTTGCAGTTCGTTTAACTAATCAGGCAAACTGGTATTTGGAGTGGCACCTTGATATATTGATA
GTTTGGGCACTAGCAAAGGTTGGAGAGACTTCAAGAGCTCATGAATTACTTGAGGGCCTTAAGTTCCGATTATCAAAGAA
GAACAAGAAGAAGCAACAAGTGATGCAGAAAGGGATTCAGCTTGGGGAAGCTGTGTATGAATACGCAAGGGGTAACTACG
AAAAGGCTCTAGAACTACTGGGTTCAGAGTTCAACGCCATTGGTTACAAGATCGTTGGGGCATCAGACGAACAAATAGAT
GTTTTCAACGAAATGTGGTGCCAGCTGCTGCTAAAGACAGGCCAATCCTCCACGGCCAAAGAAGTAATCAGAGAGAGGAT
TAAGGCCAGAGATGGTATTCCTTTCATGTGGCGTTTGCTGGAGAAAAGTTACTCCATGGAAGGCAATGCAGAGGCTGAGA
GTAGTGCACGAGAGAGAGCTAAGAAACTTGAATCTTGTTATTTCTAA