Details for Amborella Locus scaffold00077.87

Position : scaffold00 ( 5`- 1270954 .. 1273843 -3` )
Annotation :
External links : CoGe
PGDD synteny : scaffold00077.87

Protein [Map View]
MDDLNRKRVEGNDYPAVFSRKRAIHELSHGLELSKQLLAHLLNSPSQPLSPKLLEENLRKIIRSISAVLASAGNSGEVSS
ANCGNQATGGSYPVRFEGGGNLDFVGGRDGKRTCKRRKVSCKRTMKVLADNPESPHAAPTDDGYAWRKYGQKDILNANHP
RSYFRCTHKNDQGCAALKQVQRMDSNQSFFEVTYIGYHTCRQFMATPPLSLDSTPSRPFFFNFESNSAIESTDYEDNPNS
PFSLSSFTTIVRNEERETNHGDIFRHDRVGFASESSEVGETLQTMESEGTEEVSGINSSSNFPTFDNFSADIDSVLPFES
PFLWSTQEWFANN*

DNA
ATGGACGATTTGAACAGAAAAAGAGTCGAGGGAAACGATTATCCGGCGGTATTCAGCCGGAAAAGGGCGATCCATGAGCT
CAGCCATGGCTTGGAACTTTCCAAGCAACTCTTGGCCCACCTCCTAAACTCTCCCTCTCAACCTTTGAGCCCCAAATTGC
TCGAGGAAAACCTTAGAAAGATCATCCGATCCATTTCCGCCGTTTTAGCTTCTGCTGGTAATTCCGGCGAAGTTTCCAGC
GCGAATTGCGGGAATCAGGCCACCGGTGGAAGTTATCCTGTGCGTTTTGAAGGAGGAGGGAATTTGGATTTTGTTGGGGG
TAGAGATGGGAAACGGACTTGCAAGAGAAGGAAGGTTTCATGCAAGAGGACCATGAAGGTGTTGGCTGATAACCCGGAAT
CACCGCATGCAGCCCCAACAGATGATGGATATGCCTGGAGAAAATATGGCCAAAAGGATATCCTCAATGCCAACCACCCA
AGGAGCTATTTCAGGTGCACCCACAAAAATGATCAGGGGTGCGCGGCCCTAAAGCAAGTGCAAAGAATGGATAGCAACCA
ATCATTCTTTGAGGTCACATACATTGGCTACCACACTTGCAGGCAATTCATGGCAACCCCACCTCTCTCTCTAGACTCCA
CTCCGAGTAGACCCTTTTTCTTCAACTTTGAATCAAATTCAGCAATAGAGAGCACTGATTATGAGGATAATCCCAACTCT
CCATTCTCTCTCTCTTCCTTCACCACAATTGTGAGAAATGAAGAGAGAGAAACTAATCATGGAGACATATTCCGGCATGA
CAGGGTTGGGTTTGCTTCAGAGTCATCAGAAGTTGGGGAAACTCTTCAAACAATGGAATCTGAAGGAACAGAGGAAGTTT
CAGGCATAAATTCCTCTTCGAATTTCCCCACTTTCGACAATTTTTCTGCTGATATTGATTCAGTCCTTCCCTTTGAATCA
CCATTCTTGTGGTCTACTCAAGAATGGTTTGCAAACAATTGA