Details for Amborella Locus scaffold00077.79

Position : scaffold00 ( 5`- 1173381 .. 1175251 -3` )
Annotation :
External links : CoGe
PGDD synteny : scaffold00077.79

Protein [Map View]
MNWVNLIITDYCMPGMTGYELLKTIKESSTLKEIPVVIVSSENFPTRIERCIEGGALEYIVKPLQVSDVKRLKCYIKLPE
GTMGT*

DNA
ATGAACTGGGTAAATTTGATAATCACTGATTACTGCATGCCTGGAATGACAGGCTACGAGTTGCTGAAAACAATTAAGGA
ATCCTCAACTCTGAAGGAAATCCCAGTGGTAATTGTGTCTTCAGAAAATTTCCCAACCCGCATTGAGAGATGCATTGAAG
GAGGAGCCCTAGAATACATTGTGAAGCCCCTTCAAGTGTCAGATGTGAAGAGGTTGAAATGCTACATCAAACTCCCTGAG
GGAACAATGGGAACTTAG