Details for Amborella Locus scaffold00010.542

Position : scaffold00 ( 5`- 9002094 .. 9019718 -3` )
Annotation :
External links : CoGe
PGDD synteny : scaffold00010.542

Protein [Map View]
MCRFWGFLPLLVLVLFPWEGLSLRFDLKSGSSKCIAEDIQINAMAVGHYSVVDLQEGQPTPDSHKITVRVTSPYGNSLHY
GDHVDSGQFSFTSTEAGDYMACFWAADHKPPETLTIEFDWRTGVAAKDWPNVAKKGQIDVMELELKKLEDTIKSIHEEMY
FLREREEEMHMLNITTNSRMAWLSFLSLVICLSVAGLQLWHLKTFFERKKLL*

DNA
ATGTGTAGATTTTGGGGCTTTCTCCCTCTCCTTGTGCTTGTATTGTTTCCTTGGGAGGGTCTGAGCCTCCGCTTTGATTT
AAAATCGGGTAGTTCAAAATGCATAGCCGAAGACATCCAGATCAATGCCATGGCTGTCGGTCATTACAGCGTCGTTGACC
TTCAAGAGGGACAGCCCACACCCGATTCTCACAAGATCACCGTCCGGGTTACGTCCCCTTATGGAAACAGTCTTCATTAT
GGGGACCATGTGGATTCTGGTCAATTTTCCTTTACATCGACTGAGGCCGGGGACTACATGGCTTGCTTTTGGGCGGCCGA
CCACAAGCCCCCTGAAACCCTCACAATTGAGTTTGACTGGAGGACTGGAGTCGCTGCCAAGGACTGGCCCAACGTTGCCA
AGAAAGGCCAGATCGACGTCATGGAGCTGGAGCTGAAAAAGTTGGAGGACACAATTAAATCTATCCATGAAGAGATGTAT
TTTTTGCGAGAGAGGGAGGAAGAGATGCACATGCTGAACATAACAACGAACTCCAGGATGGCCTGGTTGAGTTTCCTATC
TCTGGTAATCTGCTTATCGGTGGCAGGGCTGCAGCTATGGCATTTGAAGACATTCTTCGAGAGGAAGAAGCTTCTCTAG