Details for Amborella Locus scaffold00010.538

Position : scaffold00 ( 5`- 8937315 .. 8948811 -3` )
Annotation :
External links : CoGe
PGDD synteny : scaffold00010.538

Protein [Map View]
MKFGKEFKAQMVPEWQEAYMDYDYLKTVLKDITHFKERRKNPAPSSGGAVNRRMTMYRAFSGLTRRYSNRHHQNKEEQVI
LVNSQRQDGVEGHETMFLRSFDEGGEYEMVFFRRLDEEFNKVNHFYKPKVEEMVNEAHSLDKQMEALIALRIIVDKPDFL
NGWTPPPPADAASRPPPPPASAPLGTPTPANIRKSGQLHLEVINEVEMSSDISDDPNANSAGPNVSNRKAPPEKLNGLAS
GPAPLDLLKHVKINITPETPRSTIQSLLMDHNIRDLQLNKNELRKTEERLKNAFIEFHRKLRVLKSYCSLNLLAFSKIMK
KYDKLSGRHASRSYLDMVDKSYLGSSEEVNRLLERVEATFIKHFANSNRVKGMNALRPKPKRQKHRITFFVGLFAGCSVA
LILTIGILIRVRQLPNEVGSTQYMAVIFPLYSLFLYIVLHMLMYAANIYFWKRYRVNYPFIFGFKQGTELGYIEVLLLSS
GLSVLALASVISNLDMEMDPKTKSFETLTELVPLGLTTLVLLILLCPFNIIYRSSRFFLLQCAFHCICAPFYKVILPDFF
LADQLTSQVHAIRGLLGYVCYYGWGDFKRRVNGCSSSSVYTSFFFIVAVIPYWSRFLQCLRRLYEEKDPMQGYNAIKYFS
TIVALVLRTSLSVQKREHWRILAVVSSVVATLLGTYWDLVIDWGLLQPNSENPWLRDKLLIPQKNVYFIAMVLNVILRLA
WLQTVLGFEIQGIHFTALTAIVACLEIIRRGIWNFFRLENEHLNNVGKYRAFKSVPLPFQYEEDDHED*

DNA
ATGAAGTTTGGTAAAGAATTCAAGGCACAGATGGTCCCAGAATGGCAGGAAGCGTATATGGACTATGATTATTTGAAGAC
GGTTTTGAAGGACATCACTCATTTCAAAGAGAGGAGGAAGAATCCAGCACCATCTTCAGGTGGAGCTGTGAATAGGAGGA
TGACAATGTATAGAGCCTTCAGTGGACTCACCAGACGCTACAGCAACCGCCACCACCAAAACAAAGAAGAGCAGGTTATA
CTGGTCAACAGTCAACGGCAGGATGGGGTGGAAGGACATGAAACAATGTTCCTCAGGTCATTTGATGAAGGTGGTGAATA
TGAAATGGTTTTCTTTAGAAGGTTGGATGAGGAATTCAACAAGGTCAATCATTTCTACAAGCCCAAGGTCGAAGAGATGG
TCAATGAAGCGCACTCCCTAGATAAACAGATGGAAGCGCTGATTGCTTTGAGGATCATCGTCGACAAGCCTGACTTTCTC
AATGGATGGACGCCACCACCTCCTGCTGATGCTGCATCCAGACCACCACCACCTCCAGCTAGTGCTCCACTGGGAACTCC
CACTCCAGCGAATATCAGAAAGTCAGGCCAACTTCATTTGGAGGTAATAAACGAAGTTGAAATGAGTAGTGATATCAGCG
ACGACCCTAATGCTAACTCAGCTGGACCTAATGTTAGCAACAGAAAAGCTCCTCCAGAAAAGTTGAATGGCTTGGCTTCA
GGACCAGCTCCTCTGGATTTGCTTAAGCATGTGAAGATCAATATCACCCCTGAAACTCCACGCTCTACTATACAGAGCTT
ATTGATGGACCATAACATTAGAGATTTGCAATTAAATAAGAATGAGCTGAGGAAAACAGAAGAGCGATTGAAAAATGCTT
TTATTGAATTCCATAGGAAACTCCGAGTTCTAAAAAGTTACTGCTCTCTGAATCTGCTTGCCTTCTCCAAGATCATGAAG
AAATATGATAAGCTATCTGGAAGGCATGCTTCCCGATCTTACTTGGATATGGTGGATAAGTCTTACCTTGGTAGCTCTGA
GGAGGTAAATAGACTTCTGGAGAGGGTAGAGGCGACCTTCATCAAACACTTTGCTAATTCAAATCGTGTGAAAGGCATGA
ATGCTCTGCGACCAAAACCCAAAAGACAAAAGCATAGAATAACATTTTTCGTGGGGCTCTTCGCTGGTTGCTCTGTGGCT
CTCATATTAACGATTGGTATATTGATCCGAGTTAGGCAGCTTCCTAACGAAGTGGGCAGTACTCAGTACATGGCTGTCAT
CTTTCCCCTTTATAGCTTATTTCTGTACATTGTTCTACACATGTTGATGTATGCTGCAAATATCTACTTCTGGAAGCGTT
ATCGTGTCAATTATCCTTTTATATTTGGATTTAAGCAAGGAACAGAGTTGGGCTATATAGAAGTCCTGCTTCTTAGTTCT
GGTCTTTCTGTACTTGCACTAGCAAGTGTCATCTCCAACTTGGACATGGAGATGGACCCCAAGACAAAAAGCTTTGAAAC
ATTGACAGAACTGGTCCCTCTTGGTTTGACAACGCTGGTTCTCCTTATATTATTATGCCCTTTCAACATTATTTATCGTT
CAAGTCGCTTCTTCCTACTTCAATGTGCATTTCATTGCATTTGTGCTCCTTTCTATAAGGTCATACTTCCTGATTTTTTC
CTCGCAGATCAGCTAACAAGCCAGGTACACGCCATTAGGGGTTTATTAGGATATGTTTGTTACTATGGTTGGGGAGACTT
CAAGCGTAGAGTAAATGGTTGTAGCAGCAGTAGTGTATATACGAGCTTCTTTTTCATTGTAGCAGTGATTCCATATTGGA
GCCGTTTTCTGCAGTGTCTCCGCCGTCTGTATGAAGAAAAAGATCCTATGCAAGGATATAATGCGATCAAGTATTTCTCA
ACAATCGTTGCTCTTGTACTGAGGACTAGTTTAAGCGTTCAGAAACGTGAGCATTGGAGGATCCTGGCTGTAGTATCATC
GGTTGTTGCCACTCTTCTTGGCACATATTGGGATCTCGTCATAGACTGGGGACTTTTGCAACCCAATTCCGAGAACCCGT
GGTTGCGAGACAAACTCCTAATTCCTCAAAAAAATGTGTACTTCATAGCTATGGTTCTAAATGTCATCCTGAGACTAGCT
TGGTTACAGACAGTTTTGGGTTTCGAGATACAGGGAATCCATTTCACGGCTTTGACGGCAATTGTGGCATGCCTGGAGAT
CATTCGACGTGGCATATGGAATTTCTTCAGGTTAGAGAATGAGCACTTGAACAATGTCGGCAAGTACCGCGCATTCAAGT
CTGTGCCTCTCCCTTTTCAATACGAAGAAGATGACCATGAGGACTAA