Details for Peach Locus ppb013270m

Position : sca2 ( 5`- 23096249 .. 23097213 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppb013270m

Protein [Map View]
MALLGKLPYKPLNSQYILTVAARFFTTQSPNFNTFPDIPTSAYYDDQVNAANRSRDFDDLPHLLNKRVKDNCFNTTNTFK
FITKTDASLSVLNDLCRTLARLDNGFALKERVRLTHRAALWRGSLCVVEMMARENHGLNACSFHPILNVVMEEAWGVVDL
MRRLGASPDLTAYNYLLIAYCFFGDLDLTTAVLKRIEEKGMSADTRTYDALVLGACKVGKVEGALVLLRRMVDDGVPMQL
STHVYMIDSLLNASFYDQAVKFVRSFSGRDTWLNKKNFGSLGYRLIKLKRFDKAKLVLDEMKSRGLDMGEKLKEKYEII*

DNA
ATGGCACTCCTTGGAAAACTTCCCTACAAACCACTAAATTCACAATATATCCTAACCGTCGCCGCCCGATTCTTCACAAC
CCAAAGCCCCAATTTCAACACTTTTCCTGATATCCCCACCTCGGCCTACTACGATGACCAGGTCAATGCCGCTAACCGTT
CCAGAGACTTCGACGACCTCCCCCACCTACTCAACAAGCGCGTGAAGGACAACTGCTTCAACACCACCAACACCTTCAAG
TTTATCACCAAAACCGATGCCTCCCTCTCCGTACTCAACGATCTCTGTCGAACTCTGGCTCGTCTTGACAATGGCTTCGC
CCTGAAAGAGCGCGTACGACTCACTCATCGCGCAGCTCTCTGGAGAGGGTCGCTGTGCGTGGTGGAAATGATGGCCCGTG
AAAACCACGGCCTGAACGCGTGTAGCTTTCACCCCATACTCAATGTTGTTATGGAGGAAGCGTGGGGCGTGGTGGATCTG
ATGAGGAGGCTTGGGGCTTCGCCTGATCTGACGGCGTACAATTATCTATTGATCGCGTATTGTTTCTTCGGAGATTTGGA
TCTGACGACTGCAGTGCTGAAAAGGATTGAGGAGAAGGGGATGAGTGCGGACACGCGTACGTACGATGCGCTGGTGCTAG
GCGCGTGCAAGGTGGGGAAGGTGGAGGGGGCTCTGGTGCTGCTGAGGAGGATGGTGGACGATGGAGTGCCGATGCAGCTT
TCGACACACGTGTACATGATTGATTCGCTGCTGAACGCGAGCTTTTACGATCAGGCGGTGAAGTTTGTGAGGAGCTTTAG
CGGGAGGGACACGTGGCTGAACAAGAAGAATTTCGGGAGCTTAGGGTATCGGCTCATCAAGTTGAAGAGGTTTGACAAGG
CAAAACTGGTCTTGGACGAAATGAAATCCAGGGGTTTAGATATGGGCGAGAAATTGAAGGAGAAATATGAGATTATTTAG