Details for Peach Locus ppb009532m

Position : sca3 ( 5`- 19512197 .. 19510485 -3` )
Annotation : [B2G] transmembrane emp24 domain-containing protein bai isoform 1
External links : CoGe
PGDD synteny : ppb009532m

Protein [Map View]
MSHINFSVILILGLMSTMAHSMRFDLQSGATKCISDDIKSNAMTVGKYSVVNHNEGFPKPDSHKVTVRVTSPYGSNYHYG
DHVESGNFAFTAAETGDYSACFWVSDRKPSTTVTIDFDWKTGVAAKDWSKVAKKGQIETMEVELTKLYDTVSSIHDEMFF
LREREEEMQQLNRSTNSKMATFSFLSLLVCLSVAGLQLWHLKMFFERKKLL*

DNA
ATGTCCCATATCAATTTTTCTGTAATTTTGATTTTGGGGTTAATGTCAACAATGGCGCATTCAATGCGTTTCGACCTTCA
ATCGGGCGCCACCAAGTGCATCTCAGACGACATAAAGAGCAATGCCATGACGGTGGGCAAGTATTCCGTCGTTAACCACA
ACGAGGGCTTTCCTAAACCTGACTCTCATAAGGTCACAGTCAGGGTGACCTCACCTTATGGAAGTAATTATCACTATGGG
GATCACGTGGAATCGGGTAATTTTGCGTTTACTGCGGCAGAGACTGGTGATTATTCAGCTTGCTTTTGGGTGTCTGATCG
TAAGCCCTCGACCACGGTGACCATTGATTTTGACTGGAAAACTGGAGTTGCTGCTAAGGACTGGTCCAAGGTTGCCAAGA
AAGGGCAGATTGAAACGATGGAAGTTGAGCTGACAAAATTATATGATACTGTGTCATCCATTCATGATGAGATGTTTTTT
CTTCGTGAAAGGGAGGAAGAAATGCAACAACTTAACAGATCAACTAACTCCAAGATGGCGACTTTTAGCTTCCTTTCCCT
TCTGGTTTGCCTGTCAGTGGCCGGTTTGCAACTATGGCATCTCAAGATGTTCTTTGAGAGGAAGAAGCTCCTCTAG