Details for Peach Locus ppa1027170m

Position : sca1 ( 5`- 27294435 .. 27292942 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa1027170m

Protein [Map View]
MDAASLAAASATTMKAVNFFATPITQRIATHPTTLTSPIPHTKPNVHALCLPNSNPRSRAISLITRCSIKPDTDTTDNEK
EQNSTVEPNLNSEPTNPSTPFSNDALSSPISTSFSSSNTKGLVLGLGFENSWDSAEVGSPVVKRFLGDEEERWYMWYYGK
SSSNPNPGSDSIGLAVSSNGVHWERGVGQVQSSQDVGAVINCGKDWWVFDTQSIRPSEVVVMSSSKVRASSAVYWLYYTG
YSAEEAENISNHSQEINLENPERFLLDGLISDKNGGIGKIFKSLPGLAISQDGRHWARIEGEHHSGALFDVGLQGEWDSS
FIAAPHVVFHESGDLRMYYHSFDLEMGNYSIGMARSRDGIKWVKLGKIIGGGRSGYFDELGAMNPCVVRNRKDGEYLMAY
EGVGGDGGRSIGLAVSPDGLKDWTRLKDDEVVLKASEDCGWDNKGVGSPCLVQMDGEEDEWRLYYRGVGIEGRTGIGMAV
SQGSDVTRFRRCAGFHL*

DNA
ATGGATGCAGCATCACTAGCAGCAGCTTCTGCTACAACAATGAAAGCCGTTAACTTTTTTGCAACTCCAATTACCCAAAG
AATAGCTACCCATCCGACTACATTAACCTCTCCAATTCCTCACACTAAACCAAACGTACACGCTCTCTGTCTCCCAAATT
CTAACCCTAGAAGCAGAGCCATTTCTCTGATAACTCGATGCTCCATAAAGCCAGACACCGACACGACTGACAACGAGAAA
GAACAGAATTCGACCGTTGAACCCAATTTAAATTCAGAACCGACAAACCCATCAACGCCCTTTTCAAATGATGCACTCTC
TTCTCCTATATCAACCTCATTTTCTTCATCTAATACCAAAGGATTGGTGTTGGGTTTGGGCTTTGAAAATTCATGGGACA
GTGCAGAAGTTGGGTCACCAGTTGTGAAGAGGTTCCTGGGTGACGAGGAAGAGAGATGGTACATGTGGTACTATGGGAAG
TCCAGTTCAAATCCAAACCCAGGTTCGGATTCGATTGGATTAGCAGTTTCAAGCAATGGGGTTCATTGGGAACGAGGAGT
TGGACAAGTTCAATCGAGCCAGGATGTGGGTGCGGTGATCAATTGCGGCAAAGATTGGTGGGTATTTGATACTCAGAGCA
TTAGGCCTTCTGAGGTAGTGGTCATGTCCAGTTCAAAGGTCAGAGCTTCCAGTGCTGTTTATTGGCTCTATTACACTGGC
TACAGTGCTGAGGAGGCAGAGAATATTTCTAATCATTCTCAAGAAATCAATTTGGAGAACCCAGAGAGGTTCCTTCTTGA
TGGTTTGATCAGTGATAAAAATGGTGGGATTGGGAAGATTTTCAAGTCTTTGCCTGGTTTGGCAATTAGTCAAGATGGGA
GGCATTGGGCTAGAATTGAAGGGGAGCATCACAGTGGGGCTCTGTTTGATGTGGGGTTGCAAGGAGAGTGGGATTCTTCA
TTCATTGCTGCACCTCATGTTGTTTTCCATGAAAGTGGTGATCTTAGAATGTATTACCATTCATTTGATTTGGAGATGGG
AAATTACTCAATTGGGATGGCAAGATCAAGGGATGGGATTAAGTGGGTGAAATTGGGGAAAATAATAGGGGGAGGAAGAA
GTGGTTACTTTGATGAGTTGGGAGCAATGAATCCATGTGTAGTGAGGAACAGGAAAGATGGGGAGTATTTGATGGCATAT
GAAGGTGTTGGTGGTGATGGTGGGAGGAGCATTGGTTTGGCTGTGTCCCCAGATGGGTTGAAGGATTGGACAAGGTTGAA
GGATGATGAGGTGGTTTTGAAGGCCTCTGAGGATTGTGGATGGGATAACAAAGGGGTTGGATCTCCATGTTTGGTTCAGA
TGGATGGGGAGGAAGATGAGTGGAGGTTGTATTATAGAGGTGTTGGGATTGAGGGAAGGACTGGGATTGGAATGGCAGTT
TCACAAGGGAGTGATGTTACAAGGTTTAGGAGATGCGCAGGATTTCATTTGTAA