Details for Peach Locus ppa025912m

Position : sca6 ( 5`- 25159753 .. 25157893 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa025912m

Protein [Map View]
GLWPEGVSSNRQSEMEELIHGREVASGQLGRVINLHNNRSLTVNGDHNHDLGSGNGEGFVNKMLGSFSNTLFISNGKEMK
EFHHHDQIIQVNTSGGGGGGAGAGAGASSWDVDHLLDHAIKCEASNEETCKSASTSSTDRRGSYKKRKTCHSWIKDSPAL
TEDGQAWRKYGQKLILNAKHPRNYFRCTHKFDQACQATKHVQQVEDDPPLFRTTYYGNHTCRDHLKACELVLDCTSPRES
SKFIRFDDNNLSSKQEHPFFSSFKSLKREECFKEETTPSDYMTTQHHNQLALSDYLVSPPDLPAFTSPGLMSGFASANTA
QLDEDAIYRKMAGFNYDDFAFDEFLQYELR*

DNA
GGTCTTTGGCCGGAGGGAGTGTCATCAAATCGGCAAAGTGAGATGGAGGAGCTGATCCACGGTCGTGAAGTTGCCAGTGG
TCAACTTGGTAGGGTAATTAATCTTCATAATAATAGGTCACTTACTGTTAATGGTGATCATAATCATGATTTGGGATCGG
GCAATGGTGAAGGTTTTGTTAATAAGATGTTGGGGTCATTTTCGAATACCCTTTTCATCTCAAATGGGAAGGAGATGAAG
GAGTTTCATCATCATGATCAGATTATTCAAGTGAATACTAGTGGTGGTGGTGGTGGTGGTGCAGGTGCAGGTGCAGGTGC
ATCATCTTGGGATGTTGATCATCTGCTTGATCATGCTATTAAGTGTGAAGCTTCTAATGAGGAGACTTGTAAGAGTGCTT
CGACCTCCTCCACGGATCGCAGAGGCTCTTACAAGAAAAGGAAGACTTGTCACTCTTGGATTAAAGACTCTCCTGCTTTG
ACTGAAGATGGTCAAGCATGGAGGAAGTACGGACAAAAACTCATCCTTAATGCCAAGCACCCAAGGAACTACTTTAGGTG
CACCCACAAATTCGATCAAGCATGCCAAGCAACCAAGCACGTACAACAAGTTGAAGATGATCCACCATTGTTTCGTACCA
CATATTATGGCAACCACACATGCAGAGACCACTTGAAAGCTTGTGAGCTGGTCTTGGATTGTACAAGCCCTAGAGAGTCT
TCAAAGTTCATCAGATTTGACGACAACAACCTCTCAAGCAAACAAGAGCACCCCTTTTTCTCATCTTTTAAATCGCTAAA
ACGAGAAGAATGTTTCAAGGAAGAGACGACGCCAAGTGATTATATGACAACCCAGCACCACAACCAATTAGCATTGAGTG
ATTATCTTGTATCACCTCCTGATCTTCCGGCATTCACGTCCCCTGGGCTCATGAGCGGGTTTGCATCGGCCAATACTGCT
CAGCTTGACGAGGATGCGATTTATAGGAAAATGGCGGGGTTTAATTATGATGACTTTGCATTTGATGAGTTTCTGCAATA
TGAGTTGAGGTAG