Details for Peach Locus ppa025256m

Position : sca2 ( 5`- 22896826 .. 22895201 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa025256m

Protein [Map View]
MGFSSKEEKSKRVLRGVKTLFFLITMLISLLLFSAPLLLVIADTLLPSAILSASSSSSLISLEALSSHFTNYDFRYSLVD
IPLISIIRSAVIFCVYSFCDGPRLSHGPYLGITTMCSLLSLVFVSLKASYVFGASGVERAEYVRATEVALFICSLVLAVG
HIVVAYRTSCRERRKLWVYKIDIEAVSACKNGFPRYQKLLQEERVK*

DNA
ATGGGGTTTTCATCAAAAGAAGAGAAATCGAAAAGGGTGTTGAGGGGTGTAAAGACACTGTTTTTCTTAATCACCATGTT
GATTTCTCTGCTTCTGTTTTCGGCTCCGCTTCTTCTTGTTATTGCTGATACTCTTCTCCCTTCGGCTATTCTATCCGCCT
CTTCTTCTTCTTCTTTGATCTCTTTGGAAGCTCTCTCTTCCCATTTCACTAACTACGACTTTCGGTACTCTCTTGTTGAT
ATTCCGCTCATCTCCATTATAAGATCAGCTGTCATATTCTGCGTTTACAGCTTCTGTGACGGGCCAAGGCTTTCACATGG
ACCGTATTTGGGGATCACAACCATGTGTTCTCTGCTATCTCTGGTGTTTGTTTCATTGAAGGCTTCTTATGTGTTTGGTG
CTTCTGGTGTGGAAAGAGCAGAGTATGTAAGAGCAACCGAAGTAGCTTTGTTCATCTGCTCACTGGTTTTGGCTGTTGGG
CATATTGTTGTGGCATATAGAACAAGTTGCAGAGAAAGAAGGAAGCTTTGGGTTTACAAAATTGACATTGAAGCTGTTTC
AGCTTGCAAAAATGGGTTCCCTAGATATCAGAAGCTTCTTCAAGAAGAAAGAGTGAAGTGA