Details for Peach Locus ppa025137m

Position : sca2 ( 5`- 22436969 .. 22436745 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa025137m

Protein [Map View]
MESQKTNGSVSFFKMPLHYPRYTKKDYQDMPEWKVNRLLAEYGLSTKGDLAHKREFAMGAFLWPELRHDPNISS*

DNA
ATGGAAAGCCAGAAAACCAACGGTAGCGTGAGCTTCTTCAAGATGCCGCTCCACTACCCAAGATATACCAAGAAGGACTA
CCAGGACATGCCTGAGTGGAAGGTCAACCGGCTTCTTGCAGAGTATGGGTTGTCTACCAAGGGTGACTTGGCTCACAAGA
GAGAGTTTGCAATGGGTGCCTTTCTCTGGCCTGAGCTGCGCCATGATCCAAACATCTCTTCATAA