Details for Peach Locus ppa024599m

Position : sca2 ( 5`- 22298713 .. 22299003 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa024599m

Protein [Map View]
MASLSATATSTAATTSSHHHPPPFYFDEKWKLSKKEGSSRSSRSSSCPLMKSSSQSRRRCSFSRKCAKLVKEQRARFYIV
RRCVTMLICWNDYSDS*

DNA
ATGGCTTCTCTGTCTGCTACTGCAACTTCTACTGCTGCCACTACAAGTTCTCATCACCATCCACCGCCTTTCTACTTCGA
TGAGAAGTGGAAGCTGTCAAAGAAAGAAGGGTCGTCGAGATCGAGCCGTTCATCTTCTTGCCCTCTCATGAAAAGCTCAT
CGCAGTCGCGGAGAAGGTGTTCTTTTAGCAGAAAGTGTGCGAAGTTGGTGAAGGAACAGAGGGCTCGATTCTACATCGTG
AGGCGCTGTGTCACCATGCTCATCTGCTGGAACGATTACAGCGATTCATGA