Details for Peach Locus ppa024384m

Position : sca2 ( 5`- 21883883 .. 21886525 -3` )
Annotation : [B2G] 31 kda chloroplastic
External links : CoGe
PGDD synteny : ppa024384m

Protein [Map View]
MVLSNRRLKQKLRETLAQSLVESVAKTDPQTDGSENPDPNSEPQSLKVLLDSVTQKPRLSKREKRRKLLALRGSEAVSGS
GTGGNFEENKGEEDKGEVESEDLGDEKKEEKKKKKRKRDEEEKNGVLSSEENEVVKEEAKKPKKKNKKKKKKKNKKRKKE
ATNEEEKKDGELGSEEQSVKETNNNSDRQTNGDVPTKVYVGGIPYYSTEDDIRSYFESCGTITEVDCLRFPDSGKFRGIA
IISLKTEAAAKRALALDGAEMGELFLKIQPYKATRANKVSDFAPQIVEGYNRIYVGNLSWDITEDDLKKLFSDCKISSIH
FGMDKETGEFRGYAHVNFSDSLSLTLALKLDQKVVCGRPVKISCAVPLKRAGTPSNSAPTNSTTTTSTNLIPVAATTNTN
SIPVATTTGADNGGLSAIGGKIKRRTCYECGEKGHISSACPKKQSADNNASM*

DNA
ATGGTTTTGTCAAACAGAAGGCTGAAGCAAAAGCTAAGAGAAACACTAGCTCAATCCTTAGTAGAATCGGTAGCTAAAAC
CGACCCGCAAACTGATGGGTCAGAAAACCCAGACCCGAATTCGGAGCCCCAGTCGCTGAAAGTGCTCCTGGACTCTGTAA
CCCAGAAACCCAGATTGTCCAAGCGAGAGAAACGTAGAAAGCTCCTTGCTTTGCGAGGTTCAGAGGCGGTGAGTGGGAGT
GGCACTGGTGGCAATTTTGAGGAAAACAAGGGCGAGGAAGATAAAGGGGAAGTGGAGTCAGAGGATTTGGGGGATGAGAA
GAAGGAGGAGAAGAAAAAGAAGAAGAGGAAGAGAGATGAGGAGGAAAAAAATGGAGTTTTGAGTTCAGAGGAAAATGAGG
TTGTGAAGGAGGAGGCTAAAAAGCCAAAGAAAAAGAATAAGAAGAAGAAGAAGAAGAAGAATAAGAAGAGAAAGAAGGAG
GCAACGAATGAGGAAGAGAAAAAGGATGGTGAGCTTGGGAGTGAGGAGCAAAGTGTCAAAGAGACAAATAATAACAGTGA
TAGGCAAACGAATGGGGATGTTCCTACAAAAGTTTATGTTGGAGGCATTCCTTATTACTCTACCGAGGACGATATTCGAA
GTTACTTTGAAAGCTGTGGCACAATAACTGAAGTTGATTGTCTGAGGTTTCCTGACAGTGGGAAGTTTAGAGGAATTGCT
ATTATTAGCTTGAAGACAGAAGCTGCCGCTAAACGAGCCTTGGCTCTTGATGGAGCTGAAATGGGTGAACTATTTCTGAA
AATCCAGCCTTACAAGGCAACTCGAGCCAATAAAGTATCTGATTTTGCCCCACAAATTGTGGAGGGGTACAATAGAATCT
ATGTTGGAAATTTGTCATGGGATATTACTGAGGATGATCTGAAGAAACTTTTTTCAGATTGCAAGATATCGTCTATACAT
TTTGGTATGGATAAGGAAACAGGTGAATTCCGAGGTTATGCTCACGTGAATTTCTCTGATAGTCTCTCGCTGACGCTGGC
ATTGAAGTTAGATCAGAAGGTTGTATGTGGAAGACCTGTCAAGATAAGCTGTGCTGTACCTCTGAAAAGAGCAGGGACCC
CTTCAAATTCTGCACCTACAAATTCAACTACAACTACAAGTACCAATTTGATACCAGTAGCTGCAACTACAAATACCAAT
TCGATACCAGTAGCTACAACTACAGGAGCTGATAATGGTGGGTTGAGTGCCATCGGTGGTAAGATTAAGAGAAGGACGTG
CTACGAGTGTGGTGAAAAGGGTCATATTTCTTCAGCTTGTCCAAAGAAGCAATCTGCTGATAACAATGCAAGCATGTAG