Details for Peach Locus ppa024253m

Position : sca2 ( 5`- 23429313 .. 23431153 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa024253m

Protein [Map View]
MEAEPERRRLRVRKPLSDCTNTIPNTKTSTNTNATATSSQSSSASTATLKRLNPKLSSATKTLVAALNPKPSAPPLPIPS
TPSRPPPISTSSSGTSDCDGFEACSVYTRRQTALKRKSKDKENTVPFSCPPAPKIRNILGKLKEDGHSSLSKESTAPRKK
KQCAAPAGKAVSMHALPQDFIEKQRAYFAEIDAFELPEEEVDSVD*

DNA
ATGGAAGCTGAGCCAGAGCGAAGAAGACTGAGAGTTCGAAAGCCTCTCTCAGATTGCACCAACACCATACCCAATACCAA
GACCAGCACCAACACCAACGCCACAGCCACCTCTTCACAATCGTCGTCAGCCTCCACCGCCACACTCAAACGCCTGAATC
CCAAGCTCTCCTCGGCCACCAAGACCCTCGTCGCCGCTTTAAACCCTAAGCCCTCTGCTCCGCCGCTCCCAATTCCTTCC
ACGCCTTCTCGCCCTCCTCCCATTTCGACCTCTTCTTCTGGTACCAGTGACTGTGACGGTTTTGAGGCTTGTTCAGTGTA
CACTCGGAGACAGACTGCACTGAAAAGGAAGAGTAAAGACAAGGAAAACACTGTACCTTTTAGTTGTCCTCCTGCACCAA
AGATCCGGAATATATTGGGTAAATTAAAGGAAGACGGACATAGCAGTCTATCAAAGGAATCCACGGCTCCTCGCAAAAAG
AAGCAGTGTGCGGCACCAGCTGGGAAAGCAGTTTCCATGCATGCCTTGCCACAAGATTTTATTGAAAAGCAGAGAGCGTA
CTTTGCCGAGATTGATGCATTTGAACTGCCAGAAGAGGAGGTCGATTCAGTTGATTAG