Details for Peach Locus ppa021891m

Position : sca2 ( 5`- 22684883 .. 22690021 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa021891m

Protein [Map View]
MSESSSTLCELLIQLSEPISESLSKAQCTQPEGNNVSLKALLEPLLPHKQPPPSPNFNDTQLHSSIRDFTFACALLSSSQ
SSIHDLLSWIPKHLSAAADLAFLKLSKAYSMAYSKKNNAKISELGLNCGSVPEEKRLLIELMPEVLPLLKNRIKESSIDK
SEDCDEVSAASARVPVGFAIAAAYQFRWFVTQIDYPHLGKLSALVIPCALTALDHWSPEIKGQGMLSFIHIAKNVYAAEL
GWYQDVILDACCQNIASSDEIWHLVVEMSVLIVTCTQQSNPRSAWFDRMLNEMLSHLERQPRNKERRVAWLRHIEPLFNG
VGLVLLAHFRRIFPLFFQWMHADDDETVLLVLKQIETIIKLTWIRNTQYVERLVDELAALYKEAALKRSREEIRNLVIRI
LILLHQCKGMQFETVWGKHRDDPNLASIVPSLGETKTTMGCPQVSVLYCASAIYSFHLNSSVEVSFSITMSSYFFLSLAA
LLFTLSLLSGSTSLPTSTTTIGATYSAGTAATYAMPPTPDKVAHAVAALGLRSLRLEASDPTLVRAFLYSNTTLLLTIPN
QMVPPLAANRSNALRWLYVHVVPFYPRTKISTISVGNDPLESSPDFSTFLLPAIRNLHLSLRDLGIHKISVSTTFSFISI
ITTPFPPSSSQFLEPALDTVVRPLLQFLRDTNSSFLVNIYPYKLYKIRSEIPIGFPLFQEHPFGFRDDLTTGVRYRNLFD
MMVDAVISAMAVAGYENIPLIVTETGWPSFSTDPNEIDANPIYAELYLKGLLCHLRSGKGSPLRKEGVSETYIYELLDKQ
MRKGRNWGILYPNLTAKYKYIQFSGSYCR

DNA
ATGTCGGAATCGTCCTCAACCCTCTGCGAGCTTCTCATCCAATTATCGGAGCCAATCTCCGAATCTCTGAGCAAAGCTCA
GTGCACTCAACCAGAGGGCAACAACGTCTCCTTGAAAGCCCTACTGGAACCTCTCCTCCCTCACAAACAACCTCCACCAA
GCCCTAACTTCAACGACACTCAACTCCACTCCTCAATCAGGGACTTCACCTTCGCCTGTGCCTTACTCTCCTCCTCTCAA
TCCTCTATCCACGACCTCCTCTCATGGATCCCCAAACACCTCTCGGCCGCTGCAGACTTGGCGTTTCTCAAACTTTCAAA
AGCATATTCCATGGCTTACAGTAAAAAGAATAACGCGAAGATTTCTGAATTGGGATTAAATTGTGGTTCGGTTCCTGAGG
AGAAGAGGTTACTGATAGAATTGATGCCTGAGGTTCTTCCATTGTTGAAGAACAGGATTAAGGAGAGCTCCATCGATAAA
TCGGAGGATTGCGATGAGGTCTCAGCGGCCTCAGCGAGAGTGCCCGTTGGCTTTGCCATTGCGGCTGCTTATCAGTTTAG
GTGGTTTGTTACACAGATTGATTATCCTCATTTGGGAAAGTTGTCTGCTTTGGTTATTCCTTGTGCTTTAACGGCTCTCG
ATCACTGGTCCCCTGAGATCAAAGGGCAGGGCATGCTTAGCTTTATACATATTGCGAAAAATGTGTATGCTGCTGAGCTT
GGTTGGTATCAAGATGTGATTCTTGATGCATGCTGCCAGAATATTGCTTCTAGTGATGAGATATGGCATCTTGTGGTGGA
GATGTCCGTACTTATTGTGACTTGTACCCAGCAAAGTAATCCTCGTAGTGCATGGTTTGATAGGATGCTAAACGAGATGT
TAAGTCACTTGGAGCGCCAACCTAGGAACAAGGAGCGCCGTGTTGCATGGCTTCGTCATATAGAGCCACTTTTTAATGGT
GTTGGTCTGGTGTTACTAGCTCATTTCAGGCGCATTTTCCCTCTTTTCTTTCAGTGGATGCATGCTGATGATGACGAGAC
TGTTTTACTGGTTCTCAAACAGATTGAAACAATTATAAAGTTAACGTGGATTAGGAACACACAGTATGTGGAAAGGTTGG
TGGATGAACTTGCTGCTTTGTACAAGGAAGCAGCATTGAAAAGGTCTCGTGAAGAAATTAGAAATCTTGTTATTCGGATA
CTGATCCTGCTCCACCAATGCAAAGGAATGCAGTTTGAAACAGTCTGGGGCAAGCACAGAGATGATCCAAACTTGGCAAG
CATTGTTCCCTCTTTGGGTGAAACAAAAACAACAATGGGCTGCCCTCAAGTCTCGGTGCTTTACTGTGCTTCTGCTATTT
ATTCATTTCACCTAAATTCCTCTGTAGAGGTCTCATTCTCCATAACCATGTCCTCCTACTTCTTTCTCTCTCTCGCCGCC
CTTCTCTTCACCCTCTCTCTCCTCTCCGGAAGCACCTCGCTTCCCACTTCCACCACCACCATCGGCGCCACCTACTCCGC
CGGAACCGCGGCCACGTACGCCATGCCACCCACTCCAGACAAGGTGGCCCACGCCGTCGCCGCCCTCGGCCTCCGCTCTC
TCCGGCTCGAAGCCTCCGACCCGACCCTGGTCCGCGCCTTCCTCTACTCCAACACCACCCTCCTCCTCACCATCCCCAAC
CAGATGGTCCCGCCCCTCGCCGCCAACCGCTCCAACGCCCTTCGCTGGCTCTACGTCCACGTAGTCCCCTTCTACCCCCG
CACCAAGATCTCCACCATCTCAGTCGGCAACGACCCTCTAGAATCTTCCCCCGACTTCTCCACCTTCCTCCTTCCTGCCA
TCCGCAACCTCCACCTCTCCCTCCGCGACCTCGGCATCCACAAGATCTCCGTCTCCACCACCTTCTCTTTCATCAGCATC
ATTACGACGCCGTTTCCCCCTTCCTCCTCCCAATTTCTAGAGCCCGCCCTGGACACCGTCGTCAGACCCTTGCTCCAGTT
CCTCCGCGACACCAATTCGTCGTTCTTGGTCAATATCTACCCGTACAAACTCTACAAAATCCGCAGCGAGATTCCAATCG
GGTTTCCCCTGTTTCAGGAGCACCCTTTCGGCTTCCGTGACGACCTCACCACCGGAGTCCGGTACCGGAACCTCTTCGAC
ATGATGGTCGACGCCGTCATTAGCGCCATGGCCGTCGCCGGTTACGAGAATATTCCGCTGATTGTGACCGAGACTGGGTG
GCCGAGTTTCAGTACCGATCCGAACGAAATTGACGCCAACCCGATTTACGCCGAGCTGTACCTCAAGGGTCTGCTGTGTC
ATCTGAGGTCCGGGAAAGGCTCGCCGTTAAGGAAAGAAGGGGTGTCCGAGACGTACATATATGAGCTGCTTGATAAGCAA
ATGAGGAAGGGGCGCAATTGGGGGATACTCTACCCCAATCTGACCGCCAAGTACAAGTATATTCAGTTCTCTGGGTCCTA
TTGCAGA