Details for Peach Locus ppa021789m

Position : sca2 ( 5`- 23678822 .. 23675310 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa021789m

Protein [Map View]
KSQINGMRSMSSCSNETMATQRIGLDHVSGDRESNSSSRSATLSDSGECSSDHNNERDQSKSLERNESSSDSDKPTFPNS
GECVSDRNNEKNEDKYSEDKESSSSSRNVTLPESEECSSEENNESDQRKSSEGDESSSESDKPTFPNSGEFVSDRNNEKN
ADKYSEDKESSSSSHNVTLPDSEECSSEQNNESDKRKSSEGDESSSESSPKATFPDLGECFPDQNKEKSTDTSSEGKESS
SSSHNASLSDSGECSSDQSNERDQSISSESNKSSSSSPKANFPDSGECFSGQNNEKSEDKSSENKEPSSSSHNACLSDSG
ECSSDQNNERNQSKSSEGNESSSSSPKANFPESGESFSDQKNERDQRKSSEGNVFGRLSPKATFPDSGECFSEQNNEKSE
DKSSEDKEFGSSSHNAVLPDTGEWTSNPTNGRYPDTSSENCDHKQLGDANLPNEEHNNQSDLNDSRDFDSEQHQLEVSNE
ICSSTEHAHNEVKDSLPITRAGSAVSMNDESINKEIDSAVRSSSTVHPEATRGSSSIVTAHMPARKSVSSDSLRSSPNEQ
LEEPQNHVPNGFDHVMSPDTFENTEFNPSSEFSGAPRDMSKSPAHRSHHAYDGSVSSYDGRDDQFFNRNIRSNIFRSEER
PRRDKFLAKNMMNRDSGFQPQARDSWSSFSDKNNHAMKNRKWDDDELMQPRRQGHPSREWNRLQTDEYMSRVPFPRRLSQ
GGYAKGGPTAQFHDEYQRNSGYLSSDKSVGAEQDKMTLLRMVYELQDQVNNLNGKASGRVAGGATWKENRIPRIPRHCSY
EASQEELFHDQNYQRYLRRHRAGSHYPPQHRKFMHIPYSSEATTSRHQVDPSYLHRGPQDWQCSAPLPLPVRCNNNGLCR
VHPDHSCWTFYDKSSASSPERYVEPDLPLWGHETRSDDLRHTRHDMNKFFREKHHLAKRHFRPIAGGAPIITCYNCLKPL
QIPADFLLFKRRCHKLRCGACSEVLKFSLLKRSHIVPYEQNAIAPPPSEVGDYNSAANGSNLASAPQPFDSQDTDPVSCS
DDYGYGLSFRASSSTDARPSLSSEIEEVPPKSTSPLHRLMGYSSPSQVMRGSRSSLTGTSSYSKQR*

DNA
AAGAGTCAAATAAATGGAATGAGAAGCATGAGCTCTTGCTCGAATGAGACTATGGCAACTCAGAGGATTGGACTGGATCA
CGTTTCTGGAGATAGAGAATCCAACAGTTCAAGTCGCAGTGCAACTCTTTCTGACTCGGGAGAATGCTCTTCAGACCACA
ACAATGAGAGGGATCAGAGTAAGTCTTTAGAGCGCAACGAATCTAGCAGCGACAGTGATAAGCCTACTTTTCCCAACTCG
GGAGAATGCGTTTCTGACCGAAACAACGAGAAGAATGAAGATAAGTATTCTGAGGATAAGGAATCTAGCAGCTCAAGTCG
TAATGTAACTCTTCCAGAGTCAGAAGAATGTTCTTCAGAGGAAAACAATGAGAGCGATCAGAGAAAATCTTCAGAAGGCG
ACGAATCTAGCAGCGAAAGTGATAAGCCTACTTTTCCCAACTCGGGAGAATTCGTTTCTGACCGGAACAATGAGAAGAAT
GCAGATAAGTATTCTGAGGATAAGGAATCTAGCAGCTCAAGTCATAATGTAACTCTTCCAGACTCAGAAGAATGTTCTTC
AGAGCAAAACAATGAGAGTGATAAGAGAAAATCTTCAGAAGGCGACGAATCTAGCAGCGAAAGTTCTCCCAAGGCTACTT
TTCCTGACTTGGGAGAATGCTTTCCGGACCAAAACAAGGAGAAGAGTACAGATACATCTTCTGAAGGCAAAGAATCTAGC
AGCTCAAGTCATAATGCAAGTCTTTCGGACTCAGGAGAATGCTCTTCAGATCAAAGCAATGAAAGGGATCAGAGTATATC
TTCAGAAAGCAATAAATCTAGCAGCTCGAGTCCTAAGGCTAATTTTCCCGACTCAGGAGAATGCTTTTCGGGCCAAAACA
ATGAGAAGAGTGAAGATAAGTCGTCCGAAAACAAAGAACCTAGCAGCTCAAGTCATAATGCGTGTCTTTCGGACTCAGGA
GAATGCTCTTCAGACCAAAACAATGAGAGGAATCAGAGCAAATCTTCAGAAGGCAATGAATCTAGCAGCTCAAGTCCTAA
GGCTAATTTTCCTGAATCGGGAGAATCTTTTTCAGACCAAAAAAATGAGAGAGATCAGAGGAAGTCTTCAGAAGGCAATG
TATTTGGCAGATTAAGTCCTAAGGCTACTTTCCCTGACTCGGGAGAATGCTTCTCGGAGCAAAACAATGAGAAGAGTGAA
GATAAGTCTTCGGAAGACAAAGAATTTGGCAGCTCAAGTCATAATGCTGTTCTTCCAGACACAGGAGAATGGACTTCAAA
TCCAACCAATGGGAGGTATCCTGATACGTCTTCTGAAAACTGTGATCATAAGCAGCTTGGAGATGCAAACTTACCAAACG
AAGAACACAACAATCAGAGTGATCTAAATGATTCTCGTGATTTTGATAGTGAGCAACATCAACTTGAAGTTTCCAATGAA
ATCTGTTCATCAACTGAGCATGCTCATAATGAAGTTAAGGACTCATTACCAATAACACGAGCAGGTTCAGCAGTATCAAT
GAATGATGAGAGCATCAACAAAGAGATTGATTCTGCTGTCAGGAGCTCAAGTACTGTCCATCCAGAGGCTACAAGGGGAA
GTAGTTCAATAGTTACTGCGCATATGCCTGCAAGGAAAAGCGTATCATCAGATTCCCTTAGATCTTCTCCTAATGAACAA
CTGGAGGAACCTCAGAATCATGTTCCGAATGGCTTTGATCATGTAATGTCTCCTGATACATTTGAAAATACAGAGTTCAA
CCCCAGCTCTGAGTTTAGTGGTGCACCTAGAGATATGTCAAAGTCCCCAGCACATAGAAGCCATCATGCTTATGATGGCA
GTGTTTCTTCTTATGATGGCAGGGATGACCAATTCTTCAACCGAAATATACGTTCAAACATTTTCCGTTCTGAAGAAAGA
CCCAGAAGGGATAAATTCCTGGCGAAAAACATGATGAATAGAGATTCAGGATTTCAACCTCAAGCAAGGGATTCCTGGTC
AAGTTTTTCGGATAAGAACAATCATGCCATGAAAAACAGAAAGTGGGATGATGATGAATTAATGCAGCCTAGAAGACAAG
GCCATCCAAGTCGAGAGTGGAACAGATTACAGACTGATGAATATATGTCTAGGGTGCCTTTCCCTAGAAGACTTTCCCAA
GGTGGATATGCAAAAGGAGGCCCTACAGCTCAATTTCATGATGAGTACCAACGCAACTCAGGCTATCTATCATCTGACAA
GTCCGTGGGAGCTGAACAGGACAAGATGACACTGTTGAGAATGGTCTATGAACTGCAGGATCAAGTTAACAATTTGAATG
GAAAGGCAAGTGGAAGGGTTGCCGGAGGAGCCACTTGGAAGGAAAATCGTATTCCGCGTATTCCGCGGCACTGCAGTTAT
GAGGCATCTCAGGAGGAACTCTTTCATGACCAAAACTATCAAAGGTATCTAAGAAGACACAGAGCAGGAAGCCACTATCC
GCCCCAGCACCGCAAATTTATGCATATACCTTACTCCAGTGAGGCAACAACTAGCAGACACCAAGTTGATCCCTCCTATT
TGCATCGTGGTCCCCAAGACTGGCAGTGCTCAGCACCATTGCCTCTTCCCGTTCGCTGCAACAACAATGGGTTATGCAGG
GTCCACCCTGACCACAGTTGCTGGACATTCTATGATAAGTCTAGTGCCTCAAGTCCCGAACGGTATGTGGAACCTGACTT
GCCCCTTTGGGGCCATGAAACAAGGTCTGATGATCTGAGGCACACAAGGCATGATATGAATAAGTTTTTTAGGGAGAAAC
ATCATTTGGCTAAGCGACATTTCCGCCCCATAGCAGGTGGAGCCCCTATCATAACTTGTTATAACTGCCTAAAACCGCTG
CAGATACCTGCAGATTTTCTCCTTTTCAAAAGGAGATGCCATAAACTTAGATGTGGTGCTTGTTCAGAGGTGCTTAAGTT
TTCCCTCCTAAAGAGATCTCATATTGTCCCATATGAACAGAATGCTATAGCCCCTCCACCAAGCGAGGTTGGGGACTATA
ATTCCGCTGCTAATGGGAGTAACTTGGCTTCAGCACCCCAACCATTTGATTCTCAAGATACGGATCCTGTGTCATGTTCT
GATGATTATGGTTATGGGCTCTCTTTCAGGGCAAGTTCCTCTACTGATGCAAGACCGTCCTTATCCTCAGAAATTGAGGA
GGTGCCACCAAAGTCAACTTCACCTCTTCATCGACTCATGGGTTACTCCTCGCCAAGCCAAGTAATGAGAGGCTCTCGAT
CATCTCTCACAGGGACAAGCTCATACTCAAAGCAGAGATAA