Details for Peach Locus ppa020529m

Position : sca2 ( 5`- 21589413 .. 21585065 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa020529m

Protein [Map View]
RKAGAEISSVLSIGKSAYGRSLFASKAIRAGDCILKVPFNAQLAPDNLNPELKALLSDDVGDVAKLAIVVLLEQKMGHDS
EWAPYISRLPRLEEMHNTIFWSEGELEMIRQSSVYQETINQRSQIQQEFLAIRTALKNFPETFESITYEDFMHAYALVTS
RAWGSTKGYSLIPFADFSNHDGTSESIVLSDEDKLFSEVLADRNYTPGEQVLIRYGKFSNATLLLDFGFTLPYNIHDQIQ
IQGSIPHHDNLREMKLELLKRHHRPVSKDDNGFSSSMDSFTIKEIRSGSGKGKGIPQSLRAFARVLCCTSPQELSDLVEE
AAQHDGRLARRPLTNISREIKAHQMLISTLTQLAEDYDASVKSLGLVSSPTTRERLSHRRQMARDLLSGELRILESASAW
LKNYCATLMATDCHRDGVCSTKQPRSRTERGEM*

DNA
CGCAAGGCCGGCGCCGAGATATCGTCCGTGCTTTCCATTGGGAAATCAGCCTACGGAAGGTCTCTGTTTGCTTCGAAGGC
TATAAGAGCCGGAGACTGCATATTGAAGGTTCCGTTCAACGCGCAGCTAGCTCCGGATAATCTCAATCCTGAACTGAAAG
CTTTACTAAGTGATGATGTTGGCGATGTTGCCAAGCTCGCCATTGTCGTTTTGCTTGAGCAGAAAATGGGCCATGATTCT
GAATGGGCCCCTTACATAAGCCGTCTTCCTCGCCTGGAGGAGATGCATAACACAATATTTTGGAGCGAAGGTGAGCTGGA
GATGATTCGCCAAAGCTCTGTGTATCAGGAAACAATTAATCAAAGATCTCAAATACAACAGGAGTTTTTGGCAATTAGGA
CGGCTCTCAAGAACTTTCCCGAAACATTCGAAAGTATCACCTATGAGGATTTCATGCATGCATATGCTTTAGTTACTTCT
CGAGCATGGGGAAGCACAAAGGGCTATTCCCTGATCCCATTTGCTGATTTTTCGAATCATGACGGGACTTCAGAATCAAT
TGTGTTGAGTGATGAAGACAAACTTTTTTCAGAGGTACTTGCTGATCGTAATTATACTCCTGGTGAACAGGTACTAATAA
GATATGGAAAATTTTCAAATGCTACTCTGCTGTTGGACTTTGGGTTTACTCTTCCATACAACATTCATGACCAGATCCAG
ATCCAGGGCAGCATACCTCATCATGATAACCTTCGTGAAATGAAGTTGGAACTTTTGAAGAGACATCACAGACCAGTCAG
TAAAGATGACAATGGTTTCAGCTCTTCAATGGATTCTTTCACCATCAAGGAAATCAGGTCTGGTAGTGGAAAAGGGAAAG
GAATTCCACAATCACTTCGTGCATTTGCTCGTGTTCTATGTTGCACCTCTCCTCAAGAACTTAGTGACCTGGTCGAGGAA
GCTGCGCAACATGATGGACGATTGGCTCGGCGTCCTTTAACGAACATCAGCAGAGAGATTAAAGCACATCAGATGTTGAT
ATCAACATTAACCCAATTAGCTGAGGATTATGATGCATCTGTTAAGTCTTTGGGGCTGGTAAGTTCTCCCACTACACGTG
AAAGACTTTCTCACCGGAGGCAAATGGCTCGGGATCTCCTTAGTGGCGAGCTTCGTATCCTCGAATCTGCTTCTGCGTGG
CTAAAGAACTACTGCGCAACCTTGATGGCAACTGACTGCCATAGAGATGGTGTATGTTCTACAAAACAACCAAGGAGCAG
GACTGAGAGGGGAGAGATGTAA