Details for Peach Locus ppa020266m

Position : sca1 ( 5`- 27393500 .. 27391378 -3` )
Annotation : [B2G] protein binding
External links : CoGe
PGDD synteny : ppa020266m

Protein [Map View]
MESHLQHKIQKYEEFVDGRLKPDLVRAIAQRDKVFEQQKVFSDLRNNIENLEKNSVTSLRTLVNLGSEVYMQADVPDTRR
IFVDIGLGFHVEFTWSEALNYISQREEKIARQIEEYTNLIASIKAQIKLVCEGIRELLQLPAEKRAPERIF*

DNA
ATGGAGAGTCACCTCCAACACAAAATACAGAAATACGAGGAATTCGTGGATGGACGCCTCAAACCAGACCTTGTTCGCGC
CATTGCTCAACGGGACAAGGTGTTTGAGCAACAAAAAGTTTTCTCGGATTTGCGGAACAACATTGAGAATTTGGAGAAAA
ACAGTGTAACCAGTCTTAGGACTTTGGTTAACCTTGGCTCTGAAGTCTATATGCAAGCTGATGTCCCGGATACACGACGC
ATATTTGTAGACATTGGACTAGGATTTCATGTGGAGTTCACCTGGTCTGAAGCTTTAAATTACATATCTCAAAGAGAAGA
AAAGATAGCCAGGCAAATTGAAGAGTATACTAACCTTATTGCATCAATCAAAGCCCAGATAAAGCTGGTATGCGAAGGGA
TCCGAGAATTACTCCAGCTTCCAGCAGAGAAACGTGCCCCAGAGAGAATTTTTTGA