Details for Peach Locus ppa018737m

Position : sca2 ( 5`- 23598077 .. 23598706 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa018737m

Protein [Map View]
MIRSRTGSRGARVNSLAVARASLEAVPRQRRRGGGKGNSAETAAAAYEKLDAWMRDSVVEIVKNLREAPLLVNVYGKGIT
DEKPRIETEKGVEEENWEVLRRKWEGGVAPFPDGVIFVEELMDDDEGEGDRNVDGDGITRAWGLVVQGKGEECGPACYLL
KTSKVKAGSGCGLGMGLGCTHFCLVRVKSFRETAQSQLKNCWLLQAQAQ*

DNA
ATGATCCGCAGCCGCACCGGATCAAGGGGTGCGAGAGTGAATTCATTGGCGGTGGCGCGGGCGAGTTTGGAAGCGGTGCC
CCGACAACGGCGTCGCGGCGGTGGAAAAGGAAATAGTGCCGAGACGGCGGCGGCGGCGTATGAGAAGTTGGACGCGTGGA
TGAGAGATTCGGTGGTGGAGATCGTCAAGAATCTTAGAGAAGCGCCGCTGTTGGTCAATGTGTACGGGAAGGGCATTACG
GACGAGAAGCCGAGGATTGAAACGGAGAAGGGGGTGGAGGAAGAGAATTGGGAGGTGCTCAGGCGAAAATGGGAGGGTGG
GGTGGCGCCGTTTCCTGACGGCGTTATCTTCGTTGAAGAACTCATGGATGATGATGAAGGTGAAGGTGACCGGAACGTTG
ACGGAGATGGGATCACGCGGGCATGGGGGCTAGTGGTGCAGGGGAAAGGGGAGGAGTGTGGGCCAGCTTGTTACTTGTTA
AAGACGAGTAAAGTAAAGGCCGGGTCGGGTTGTGGGCTGGGGATGGGCTTGGGATGCACTCATTTTTGCTTGGTTCGGGT
CAAGAGTTTCAGGGAGACGGCCCAATCTCAGTTGAAGAATTGCTGGCTATTGCAGGCCCAGGCCCAATGA