Details for Peach Locus ppa018704m

Position : sca2 ( 5`- 21288915 .. 21286241 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa018704m

Protein [Map View]
MLDLNVNITLTSDASFDYEKTKDMEVEELPQGSRTQMEDSGTSNSSVVNAEEAPTPSNAGEEDSTNNTTSSFVFDILKKD
KDGLCNTTYYGGAKDQNPSLQFVTRSLFPVTGDGGGGNEAECGLGLSSASSTARPQWLNLSFAESGGQAQAELRIMQQKK
PQPRKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHSAARAYDRAAIKFRGVDADINFTLGDYEEDM
KQLGHLNKEEFVHVLRRQSTGASRGNSKYRGVALPKCGGAGGRWEARMAQFPEKKVFEKEGIKYNTGREAAAVTNFVDPS
IYEGEVVLDASIEGSGHNLDLSLGISQPSSGQKGNGNLGDFQFRYKERPMVNGSAASAAVGQTPHVLTMVAKHPALYSGM
YPGFLQKYEEMDSDHNGAQAVSSPRYTNLAWQVHGNSHSVSPVQVFSIAASSGFPSSMASTAPPAANYFPPNLQGSASAS
YNVGPLPFPTPSTM*

DNA
ATGTTGGATCTTAATGTTAACATCACCCTCACCAGTGATGCCAGCTTTGATTATGAGAAGACAAAAGATATGGAGGTCGA
GGAGCTTCCACAGGGCTCAAGGACCCAAATGGAAGACTCCGGGACCTCAAACTCCTCCGTTGTCAATGCCGAAGAAGCTC
CGACTCCGAGCAATGCCGGCGAGGAAGATTCAACTAACAACACTACCTCATCTTTCGTCTTTGATATCTTGAAGAAAGAC
AAAGACGGTCTCTGCAACACTACCTATTACGGTGGGGCCAAAGACCAAAACCCATCTCTACAATTCGTGACAAGGTCGCT
TTTTCCGGTGACCGGAGACGGCGGAGGAGGCAACGAGGCAGAGTGTGGGTTGGGATTGTCTTCGGCGTCGTCGACGGCAA
GGCCTCAGTGGCTGAACTTGTCGTTTGCTGAGTCTGGTGGCCAAGCTCAGGCCGAGCTGAGAATTATGCAACAGAAAAAA
CCGCAGCCTCGGAAAAGCAGAAGGGGGCCTAGATCTCGGAGCTCTCAGTACCGCGGCGTCACGTTTTACCGGAGAACAGG
GCGGTGGGAATCGCATATATGGGATTGTGGGAAGCAGGTATATTTAGGTGGATTTGATACTGCTCATTCTGCAGCTAGAG
CATACGATCGGGCTGCAATCAAGTTTAGGGGAGTTGATGCTGATATCAATTTTACTTTAGGCGATTATGAGGAAGATATG
AAACAGCTGGGGCATCTGAATAAAGAAGAATTTGTGCACGTGCTTCGTCGCCAAAGCACCGGAGCCTCACGTGGGAACTC
AAAATATAGAGGTGTAGCTCTGCCCAAATGTGGTGGTGCTGGTGGTAGATGGGAAGCTAGGATGGCACAATTTCCTGAGA
AAAAGGTCTTTGAGAAGGAGGGCATCAAATACAACACAGGAAGAGAAGCAGCAGCAGTTACCAACTTTGTTGACCCTAGC
ATCTATGAAGGGGAGGTGGTTTTAGATGCAAGCATTGAAGGCAGTGGCCATAACCTTGATCTCAGCCTTGGGATTTCTCA
GCCTTCTTCTGGTCAAAAGGGCAATGGCAATCTGGGGGATTTTCAATTTCGTTACAAAGAGAGGCCAATGGTTAATGGCT
CTGCTGCTTCTGCAGCTGTGGGGCAAACCCCTCATGTTCTAACAATGGTAGCCAAGCATCCTGCCTTATATTCTGGGATG
TATCCAGGTTTCTTACAAAAATATGAGGAAATGGATTCAGATCACAACGGAGCCCAAGCTGTTTCTTCACCGAGATATAC
AAACTTGGCATGGCAAGTTCATGGAAACAGCCACAGTGTTAGCCCAGTGCAAGTGTTTTCTATTGCAGCATCATCAGGAT
TCCCATCTTCTATGGCTTCTACAGCTCCTCCAGCAGCTAATTATTTTCCACCAAACCTCCAAGGCAGTGCTTCTGCCTCC
TACAACGTCGGCCCCCTTCCTTTTCCTACCCCATCCACCATGTAA