Details for Peach Locus ppa017638m

Position : sca2 ( 5`- 22574751 .. 22576684 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa017638m

Protein [Map View]
MENKNQVGGGGSSHASSSSSRTLDHLFGPKDSSSSSSSSLFGSIFPPPPSAGLGSSGKYGNPSALDNKSQGFYTSKGEST
KGASKDSMIYQNEAVEPCNFSSSIYYGGQENYSPRTGTTTESHQHHLSKKDGGDDDANGNNSNGASRGNWWKDDIHTSAL
VTPRTSSNFAAFRNGDGNYRGDPKALSFFRKDDGTKAACADLLHQGAAIGRNLHILILCGGCTGC*

DNA
ATGGAGAACAAGAACCAAGTGGGTGGTGGTGGTTCAAGCCATGCCTCTTCTTCTTCTTCCAGGACTCTGGATCATCTCTT
TGGCCCTAAGGACTCTTCTTCATCTTCTTCATCCTCCTTGTTTGGCTCTATTTTCCCACCACCACCATCAGCGGGACTTG
GGAGCAGTGGCAAGTACGGAAATCCAAGCGCTTTGGATAATAAGAGCCAAGGGTTTTACACCAGCAAAGGTGAAAGCACG
AAAGGCGCAAGCAAAGATTCCATGATATATCAAAATGAAGCTGTGGAGCCATGCAACTTCAGCTCCTCAATCTACTATGG
TGGCCAAGAAAATTATAGTCCAAGAACTGGGACGACCACTGAATCCCACCAGCACCACCTTTCTAAGAAAGATGGGGGTG
ATGATGATGCAAATGGGAATAATTCAAACGGTGCTTCAAGGGGAAACTGGTGGAAGGATGACATACATACCTCCGCACTT
GTAACCCCTAGGACGTCCAGCAATTTTGCAGCGTTTAGGAATGGTGACGGCAACTACAGGGGTGATCCCAAGGCTCTTAG
CTTCTTTAGAAAGGATGATGGCACAAAGGCAGCTTGTGCGGACCTTCTGCATCAGGGCGCAGCAATTGGGAGGAACCTCC
ACATTCTTATCCTGTGCGGCGGCTGCACAGGGTGCTAG