Details for Peach Locus ppa016920m

Position : sca2 ( 5`- 23425561 .. 23424048 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa016920m

Protein [Map View]
MDCSICTSMPAILRPPRNTICLTCYEGARSVISFINKLESAQGSAEKKANLSFLFWSQLRRPRMRGYNEEVLNNHPSNPT
LENVSKWVHDRKDASEELNEKIKFLSGFVVAFRDQIHTDIQLHPGDNGPPIPAHRALLAIRSEIFNNMLDSDGCKAPPND
AVTLPELNHEELESLLEFLYNGDLHEEKMNKHVYSLFLAADKYGISYLQKLCERHMLESLSTANALDVLEVADLCSCLTL
KNNALDFIVKNMHDIVFSAKYDAFALKNPHLCVQISRASLMDAKRNSVS*

DNA
ATGGACTGTTCTATTTGTACTTCAATGCCGGCTATATTGAGGCCTCCAAGGAATACAATATGCTTGACATGCTACGAGGG
AGCCCGTAGCGTTATCTCCTTCATAAACAAGCTTGAAAGTGCTCAAGGATCAGCTGAGAAGAAAGCAAATTTGTCCTTCT
TGTTTTGGTCACAACTCCGGAGACCTAGAATGAGGGGTTATAATGAGGAAGTCCTTAATAACCATCCGTCTAATCCCACT
CTGGAGAATGTGTCAAAATGGGTGCATGATAGGAAGGATGCATCAGAGGAACTCAATGAGAAGATTAAATTCCTAAGTGG
ATTTGTTGTTGCATTTAGAGATCAAATTCACACAGACATTCAACTCCACCCTGGTGATAATGGGCCTCCAATACCTGCAC
ATAGAGCCTTATTGGCAATACGATCGGAAATCTTCAACAACATGCTAGACTCAGACGGGTGCAAAGCTCCACCAAACGAC
GCCGTAACATTGCCAGAGTTGAACCATGAAGAGCTTGAATCTCTCTTGGAGTTCCTGTACAATGGGGACTTGCATGAAGA
AAAGATGAACAAGCATGTGTACTCCTTGTTCCTTGCAGCAGATAAATACGGAATCTCGTACCTACAGAAGCTTTGTGAGC
GCCATATGCTCGAGTCTCTGAGCACAGCCAATGCTCTTGATGTTTTAGAGGTTGCAGATCTTTGTTCGTGCCTGACTTTG
AAGAACAATGCCTTGGACTTCATTGTCAAAAACATGCACGACATAGTTTTCTCAGCTAAGTATGATGCATTTGCACTTAA
GAATCCTCATCTTTGTGTACAGATTTCAAGGGCATCATTGATGGATGCCAAAAGAAATTCAGTTTCCTAG