Details for Peach Locus ppa016586m

Position : sca1 ( 5`- 27395382 .. 27394309 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa016586m

Protein [Map View]
MEAYTENSPRMRLDHSKKEGSEETHLLRFELEPTGNDHRFHSMNALEILRETVRILRYNSWGFLAIAALLICPLSALLLS
NLLVDQSLVKRLTIRMLLIAKSSGLPLRDFISHSCQRFAEMAISSTMCFPLYITLSLLSKAAVVYSVYCSYSLKKFDVSQ
FYLIMCKIWRRLLSTYVWMCMVVVGCLILFLILLLAVCNTCSIFGLSPPHIVYAAMVVGLIFSVIFANAIIICNIAIVIS
VLEDVSGPEALVQSGVLIKGQTQVGLLIFLGSTIGMAFVEGLFEHRVKTLSYGDGSSRIWEGPLLVIMYSFVVLIDSMMS
AVFYFSCRSFKMETSLDSESHSILETINFSAESVGIQ*

DNA
ATGGAAGCTTATACTGAAAATTCCCCAAGAATGAGATTGGATCATTCAAAGAAAGAGGGATCCGAAGAAACCCATTTGTT
GAGATTTGAGTTAGAACCTACTGGTAACGATCATAGGTTCCATTCAATGAATGCTCTGGAGATTTTGAGGGAAACTGTGA
GAATTCTCCGGTACAATTCGTGGGGCTTTTTGGCCATTGCCGCCTTGCTAATTTGCCCTTTGTCTGCCTTGCTTTTGTCG
AATTTGCTGGTTGATCAGTCACTTGTAAAGAGACTAACGATTAGGATGTTGTTAATTGCCAAGTCCAGTGGCCTCCCTTT
GAGGGATTTTATCAGTCATTCTTGCCAGAGGTTTGCTGAGATGGCTATCTCATCCACTATGTGCTTTCCTCTGTACATCA
CATTGTCTTTGTTGTCGAAAGCCGCCGTGGTTTACTCTGTGTATTGTAGTTACTCCCTGAAGAAGTTTGATGTATCCCAG
TTTTACTTAATTATGTGCAAAATATGGAGACGGCTTCTTTCGACGTATGTGTGGATGTGTATGGTGGTTGTGGGTTGCCT
CATCTTGTTTTTGATTCTTCTTCTTGCTGTGTGCAATACATGTTCCATATTTGGGTTGTCACCTCCTCATATTGTATATG
CTGCAATGGTGGTTGGCCTCATCTTCTCGGTTATTTTTGCCAATGCTATTATTATTTGCAACATTGCTATTGTGATCTCT
GTGTTGGAGGATGTCTCAGGACCAGAGGCATTGGTTCAGTCTGGGGTTTTAATCAAGGGCCAGACTCAGGTGGGTCTTTT
GATATTTCTTGGATCAACAATCGGAATGGCATTTGTTGAGGGGCTGTTTGAGCACAGAGTGAAGACGTTGAGCTACGGAG
ATGGGTCTTCTCGCATATGGGAAGGGCCTCTTTTGGTGATCATGTATTCGTTCGTGGTGCTCATCGACTCCATGATGAGT
GCTGTTTTCTACTTCAGCTGCAGATCTTTTAAGATGGAAACATCTTTAGACAGCGAGTCTCATTCAATTTTGGAAACCAT
AAACTTTTCTGCTGAATCAGTTGGTATTCAATGA