Details for Peach Locus ppa015934m

Position : sca2 ( 5`- 23703377 .. 23702318 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa015934m

Protein [Map View]
MCSGHNSDEIHFEGCLASGNVHLIKTMESWEAKLSEAVKDGKIVVANFSASWCRPCIMIAPAYCELADKYPSIVFLTLDV
DDLAELSTSWDIKATPTFIFLKDGRQVDKLVGSNKPELQKKTAAVAHLATKSHS*

DNA
ATGTGCTCCGGGCATAATAGCGACGAGATTCATTTTGAGGGTTGTCTTGCCAGTGGAAATGTGCACCTTATAAAGACCAT
GGAAAGTTGGGAGGCAAAGTTATCAGAAGCAGTCAAGGATGGCAAGATTGTTGTAGCAAATTTCAGTGCATCGTGGTGTA
GACCTTGTATAATGATTGCACCAGCCTACTGTGAGCTTGCTGACAAGTATCCTTCTATCGTATTTCTAACCTTGGATGTC
GATGATCTTGCTGAGTTGAGTACTTCATGGGATATAAAGGCCACTCCGACATTTATTTTTCTTAAAGATGGAAGACAAGT
GGACAAACTTGTTGGAAGCAACAAGCCAGAGCTCCAGAAGAAGACAGCAGCTGTGGCTCATTTAGCAACCAAGTCTCATA
GTTGA