Details for Peach Locus ppa014826m

Position : sca2 ( 5`- 23638750 .. 23643347 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa014826m

Protein [Map View]
MACPFSLILHACKLARDLESNLPNLANQPNLLSNSLDEITRNFVTARERVYGQDPSTSSSLHNMLTLAHQQQIGTSQVQE
WLRSSYAQQAMDIIQTQLVADQKEVKIGGCIDDGDAEVKGLQAMDIVSASDTNIASSSSQRPRRRKDEGLISKITVPAPR
IGNTEIPPEDGFTWRKYGQKEIMGSRFPRGYYRCTHQKLYNCPAKKQVQRLNNDPLTFEVMYRGEHTCHMSATAPSVPPP
SAEHHNATQGSLAQTLATTTTTDPPTASLWLSMDFNPIRGGSGSSSRMIGGDRGGGGGGSGDGAGTSTTTRYGKEVDFPV
VDWADAMFNSGSSSSNNVKCEPNFFSLD*

DNA
ATGGCATGCCCTTTTTCTTTGATCCTTCATGCTTGTAAGTTAGCCAGAGACCTTGAATCAAACCTACCCAACTTGGCCAA
CCAGCCCAACTTGCTCTCAAACTCCTTGGATGAGATCACAAGGAATTTTGTTACAGCCAGAGAGAGAGTGTATGGTCAAG
ATCCAAGTACTTCTTCATCTCTGCACAACATGCTTACTCTTGCGCACCAGCAGCAGATTGGTACAAGTCAAGTACAAGAA
TGGCTGAGGTCTAGTTATGCACAACAAGCGATGGACATTATCCAAACCCAACTTGTAGCTGATCAGAAGGAAGTTAAGAT
TGGCGGCTGCATCGATGACGGTGATGCAGAGGTTAAGGGCCTTCAGGCAATGGATATAGTATCAGCTTCTGACACGAACA
TTGCTTCATCATCCTCACAAAGACCGAGAAGAAGGAAGGATGAGGGATTAATCAGCAAAATAACAGTTCCAGCACCTCGG
ATTGGAAATACTGAAATCCCACCAGAGGATGGCTTCACTTGGAGAAAATATGGTCAGAAGGAGATCATGGGCTCCAGGTT
CCCAAGGGGTTACTATAGGTGCACCCACCAAAAGCTCTACAATTGCCCAGCCAAGAAGCAAGTCCAGAGGCTTAACAATG
ATCCCTTAACATTTGAAGTAATGTACAGAGGTGAACATACTTGTCACATGTCAGCCACTGCACCTTCAGTTCCACCACCA
TCAGCAGAACATCATAATGCTACGCAAGGGAGTCTGGCCCAAACCCTAGCAACTACCACAACCACTGACCCTCCTACAGC
ATCTCTATGGCTGTCCATGGACTTTAACCCAATTAGAGGAGGCAGCGGCAGCAGCAGTAGGATGATAGGCGGCGACCGTG
GCGGTGGTGGTGGAGGCAGTGGTGATGGTGCAGGCACATCCACCACCACGCGCTACGGTAAAGAAGTTGACTTTCCTGTG
GTGGATTGGGCTGACGCAATGTTCAATTCAGGCAGCAGCAGCAGCAATAACGTGAAATGTGAACCCAACTTTTTTTCTTT
GGACTGA