Details for Peach Locus ppa014810m

Position : sca1 ( 5`- 27301227 .. 27305135 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa014810m

Protein [Map View]
MKFGKEFKKKMVPEWAEAYMDYNGLKRILRELREYKQRTHSRDLLDHKIAAAAGAPPPNRIISGIELQISSLQNTNGDIE
DQVIDVNTLHGDGCRQFYKTKFLRQSEEGGEIEVTFFRKLDEELNKVNTFYKDKVEEVKQEANHLDKQMEALVALRIKVK
NPKQYGSNSKRHRNSAVPLTRNEPMGLTSENEQHQVEPSPGASEVNPTQIKNPGSDDREVLNIFDYREDPLEVLEHVKIK
NTLESPISTIKGVFKDSREEELSFGKEELKRVEERLRAVFIQFYHKLQLLKHYSFMNLSAFSKIMKKYEKITSRGAARSY
MLIVDNSYLGSSDEVTNLLERAEATFIQNFSNSNRREGMKSLRPKAKREKHAVTFFSGFFCGCSIALMVAIILRIEARKL
MDKEEGAQYMENIFPLYSLFGYITLHMLMYAADIYFWRRYRVNYAFIFGFKKGTELGYQEVFLLSSGLAVLALGGLLANL
HLDMDSSAEKYKTLTELVPLGLLILVLAITFCPFNIIYRSSCFFFIRCLFRCICAPLYQETFPDFFLADQLTSQVQALRS
FVLYICYYGLGEYSRRQSKCHSHGVYNTLYFIIAVIPFWMRFLQCIRRFCEEKDVKHMCNGLKYFSTIVAVIIRTAYELK
KGKTSWMVLALICSAVATTMNMYWDIVVDWGLLRTKSKNKYLRDRLLVSHKIIYFAAMVLNVVLRLAWMQLVLEFKLSTV
HKMTISTIIFFLEVIRRGIWSFFRLENEHLNNVGDYRAFKSVPLPFSYYDEDAEKDD*

DNA
ATGAAATTCGGGAAAGAGTTCAAGAAGAAAATGGTGCCTGAGTGGGCAGAAGCCTACATGGATTATAATGGTCTCAAGAG
GATACTAAGGGAGCTCAGAGAATACAAGCAGAGGACGCACTCTAGAGACTTATTAGACCACAAAATTGCTGCTGCTGCTG
GTGCTCCTCCTCCTAACAGAATCATCAGTGGAATAGAGCTACAAATTAGCAGTCTCCAGAACACTAATGGAGATATCGAG
GACCAAGTGATAGATGTCAACACATTGCACGGAGATGGTTGCAGGCAGTTTTACAAGACCAAATTCCTGAGGCAGTCTGA
AGAGGGTGGAGAAATTGAGGTAACATTCTTCAGAAAACTCGACGAAGAGCTCAACAAGGTCAATACTTTTTACAAGGACA
AGGTGGAGGAGGTGAAGCAAGAAGCAAATCATTTGGATAAACAAATGGAGGCTTTGGTTGCACTCAGGATTAAGGTGAAG
AATCCAAAACAATATGGCTCTAATTCAAAGAGACATAGGAATTCTGCAGTGCCGCTGACAAGAAATGAGCCTATGGGTTT
GACATCTGAAAATGAGCAGCATCAAGTAGAACCGAGCCCTGGTGCTTCAGAAGTCAATCCAACCCAAATAAAAAATCCTG
GTAGTGATGACAGAGAGGTGTTGAATATCTTTGACTACAGAGAAGATCCTCTGGAGGTTCTTGAGCATGTGAAGATTAAG
AATACACTTGAATCTCCAATATCAACCATAAAAGGTGTTTTTAAAGACTCCAGAGAAGAAGAGTTGAGCTTTGGTAAAGA
GGAGCTAAAGAGAGTTGAAGAACGACTAAGAGCTGTGTTCATTCAATTTTACCATAAGCTTCAACTGCTTAAGCACTACA
GTTTTATGAACCTCTCAGCATTTTCGAAGATTATGAAAAAGTATGAGAAGATCACATCAAGGGGAGCAGCCAGATCATAC
ATGCTAATAGTCGATAACTCCTACCTTGGCAGTTCTGATGAGGTTACTAACCTCTTGGAGAGGGCGGAGGCTACCTTCAT
ACAAAACTTTTCAAACTCAAATCGCAGGGAAGGTATGAAGTCATTGAGACCAAAAGCAAAAAGAGAAAAGCATGCTGTAA
CATTTTTCTCCGGTTTCTTTTGTGGTTGCTCAATTGCACTAATGGTTGCTATTATATTAAGAATAGAAGCTCGAAAACTA
ATGGATAAGGAGGAGGGTGCACAATATATGGAAAATATTTTCCCACTCTACAGTTTATTTGGATACATCACTCTACACAT
GCTCATGTATGCAGCAGATATATACTTCTGGAGGCGTTATCGAGTCAACTATGCCTTTATATTTGGTTTCAAGAAAGGAA
CTGAGTTGGGTTACCAAGAAGTCTTCCTCCTTAGCTCTGGTCTTGCAGTACTTGCATTGGGTGGTCTCCTGGCAAACTTA
CACTTGGACATGGACTCAAGTGCTGAAAAATACAAGACACTTACTGAATTGGTTCCTTTGGGCTTACTTATTTTGGTCCT
TGCCATCACCTTCTGCCCTTTCAACATCATATACCGTTCAAGTTGTTTCTTCTTCATTCGGTGCTTATTCCGCTGCATAT
GTGCCCCTCTTTACCAGGAGACATTTCCAGACTTTTTCTTGGCAGACCAGCTTACTAGCCAGGTGCAAGCCTTAAGGAGT
TTTGTGTTATACATTTGCTACTACGGTTTGGGAGAATACTCAAGGAGGCAAAGCAAGTGCCATAGTCATGGTGTCTACAA
TACTTTATATTTCATTATTGCTGTCATACCATTTTGGATGCGCTTCCTACAGTGCATACGTCGATTTTGTGAAGAAAAGG
ATGTGAAGCACATGTGCAATGGTTTAAAATACTTCTCAACAATTGTTGCAGTTATTATAAGAACTGCTTATGAACTAAAA
AAGGGAAAGACATCCTGGATGGTGTTGGCTTTGATATGCTCGGCTGTTGCAACAACAATGAATATGTATTGGGACATTGT
AGTAGACTGGGGCCTTCTGCGAACAAAATCAAAGAACAAGTATTTGAGAGATAGACTTCTAGTTTCACACAAGATCATAT
ACTTCGCAGCCATGGTCTTGAATGTAGTATTGCGACTTGCTTGGATGCAGTTGGTGTTGGAATTTAAACTGAGTACCGTT
CATAAAATGACAATATCTACCATCATCTTCTTCCTAGAGGTCATTCGTCGTGGCATCTGGAGCTTCTTCAGATTAGAGAA
CGAGCACCTAAACAATGTAGGCGACTACCGCGCTTTCAAGTCCGTCCCTCTTCCTTTCAGTTACTACGATGAGGACGCAG
AAAAGGATGACTGA