Details for Peach Locus ppa013960m

Position : sca2 ( 5`- 21740264 .. 21739174 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa013960m

Protein [Map View]
MGDSSSASYIHMVQHLIEKCLIYHMSKEECMEALSKHANIEPVITSTVWNELEKVNKEFFEAYAQSQNKGDRMSEEETSQ
LIQKMISDSKDSDD*

DNA
ATGGGAGATTCTTCATCAGCATCGTACATACACATGGTGCAGCACCTGATAGAGAAGTGCCTGATCTACCACATGAGTAA
AGAAGAGTGCATGGAAGCTCTGTCTAAGCATGCAAACATCGAGCCTGTCATCACCTCCACCGTTTGGAATGAACTGGAGA
AAGTGAACAAGGAGTTCTTCGAGGCGTATGCACAGTCTCAAAACAAAGGAGATCGAATGTCAGAGGAAGAGACAAGCCAA
TTGATCCAAAAGATGATATCGGATTCCAAAGATTCCGACGACTAG