Details for Peach Locus ppa013635m

Position : sca2 ( 5`- 22667691 .. 22668394 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa013635m

Protein [Map View]
MVKERQGERIRLYVGGTVLGYKRSKSNQYPGTSLIQINGVNTKEEVAWYAGKRLAYIYKAKVKKNGSHYRCIWGKVSRPH
GNSGIVRAKFTSNLPPKSMGARVRVFMYPSNI*

DNA
ATGGTGAAGGAACGCCAAGGAGAACGAATTAGACTCTACGTCGGGGGCACCGTTCTCGGATACAAAAGGTCTAAGTCGAA
CCAATACCCAGGCACCTCCTTGATTCAGATCAATGGAGTGAACACCAAAGAGGAGGTGGCATGGTACGCTGGAAAGCGCT
TGGCGTACATCTACAAGGCCAAGGTGAAGAAGAATGGGAGCCACTACCGCTGCATTTGGGGCAAGGTTTCCAGGCCTCAT
GGTAACAGTGGCATCGTTCGTGCTAAGTTCACTTCCAATTTGCCACCCAAATCCATGGGTGCTCGTGTTAGGGTATTCAT
GTATCCCAGCAATATATAA