Details for Peach Locus ppa013427m

Position : sca2 ( 5`- 21708655 .. 21707857 -3` )
Annotation : [B2G] rl35_eupes ame: full=60s ribosomal protein l35
External links : CoGe
PGDD synteny : ppa013427m

Protein [Map View]
MARIKVHELRQKTKAELLNQLKDLKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKSALREVYKNKKFLP
LDLRPKKTRAIRRRLTKHQASLKTEREKKKEMYYPLRKYAIKA*

DNA
ATGGCGAGAATCAAGGTACACGAGCTGAGGCAGAAAACAAAGGCTGAGCTTTTGAACCAGCTCAAGGATCTCAAGGCAGA
GCTTGCCCTTCTTCGCGTGGCCAAGGTCACTGGTGGAGCACCCAATAAGCTCTCCAAGATCAAGGTTGTGAGGCTATCGA
TCGCCCAAGTGTTGACTGTGATATCACAGAAGCAAAAGTCTGCCCTGAGAGAAGTGTACAAGAACAAGAAGTTCTTGCCT
CTTGATCTGCGTCCCAAGAAGACCAGAGCTATCCGCCGAAGGCTCACCAAGCACCAGGCATCTTTGAAGACCGAGAGGGA
GAAGAAGAAGGAAATGTATTATCCCTTGAGGAAGTATGCCATTAAGGCATAG