Details for Peach Locus ppa013117m

Position : sca6 ( 5`- 25212316 .. 25210217 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa013117m

Protein [Map View]
MGACVSKSKTKEQDSEQSGAEFTGANVHLITTTESWDQKMEEAKRDGKTVIANFSATWCGPCKMIAPLYRELSEQYTSLM
FLVIDVDELTDFSTSWDIKATPTFFFLRDGQQIDKLVGANKPELQKKIISVVDSAPCQK*

DNA
ATGGGAGCTTGCGTGAGCAAGAGTAAAACTAAAGAACAGGATTCTGAACAAAGTGGTGCTGAGTTTACTGGTGCGAATGT
GCACCTCATCACCACCACAGAAAGTTGGGATCAAAAGATGGAAGAAGCAAAAAGGGATGGCAAAACTGTGATTGCAAACT
TCAGTGCAACATGGTGTGGTCCTTGCAAAATGATTGCACCACTATATCGCGAGTTATCGGAGCAATACACTTCTCTAATG
TTCCTTGTGATCGATGTTGATGAACTGACTGATTTCAGTACTTCATGGGATATCAAAGCCACTCCCACTTTCTTCTTCCT
TCGGGATGGCCAGCAAATCGACAAGCTAGTGGGAGCCAACAAGCCAGAGTTGCAGAAGAAGATAATTTCCGTAGTAGATT
CTGCCCCGTGCCAGAAATGA