Details for Peach Locus ppa012668m

Position : sca2 ( 5`- 23421623 .. 23423002 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa012668m

Protein [Map View]
MVSREHKRAALYEKLQLLRSITNSHALNKTSIIVDASKYIEELKQKVERLNEDAANAQTSSSSSDQTPLPVVTVETLEKG
FLINVFSEKSCPGLLVSVLEAFEDLGLNVLEARVSCADSFRLQAVGGENEEEGESIDAHAVKQAVAVAIKNWSENNEHE*

DNA
ATGGTTTCTAGGGAGCACAAGAGGGCAGCACTTTATGAGAAGCTGCAGCTTCTTCGTTCTATTACTAATTCTCATGCTCT
AAACAAAACCTCAATCATAGTAGACGCATCAAAGTACATTGAAGAGCTAAAACAAAAGGTGGAAAGACTGAATGAAGATG
CTGCAAATGCGCAAACTAGTTCATCATCAAGTGACCAAACTCCATTGCCTGTGGTTACAGTGGAAACCCTAGAAAAGGGG
TTTCTGATAAATGTGTTTTCTGAAAAGAGCTGCCCAGGTTTGCTTGTCTCTGTACTGGAAGCTTTCGAGGACTTGGGTCT
TAATGTGCTTGAAGCTAGGGTTTCCTGTGCAGACAGTTTCCGGTTGCAGGCAGTTGGAGGAGAAAATGAGGAAGAAGGTG
AAAGCATTGATGCTCATGCAGTGAAGCAAGCAGTGGCAGTGGCTATTAAAAACTGGAGTGAAAACAACGAACACGAGTAA