Details for Peach Locus ppa012134m

Position : sca2 ( 5`- 23066977 .. 23068580 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa012134m

Protein [Map View]
MAVSFYSAVGFNSMVISCSSYAPFRLFQFQTSVLDQSGTQTSEPSNGSSVSSSQERDAPLSPNVQSKSKRLPLTARERLR
AAKVLRRYNTETKPTKKSERGKNVLDALRDSERGKKRSGLPEAPTNIFDDSKRGMPKQGLTWDFPGGADLFLIIFSFVFI
STVMFATTYVVWKLGAIHFNEN*

DNA
ATGGCTGTTTCATTCTACTCGGCCGTTGGCTTCAATTCTATGGTAATTTCATGCTCCTCTTATGCACCATTCCGTCTTTT
TCAGTTCCAAACTAGTGTCCTAGATCAGTCAGGGACTCAAACCTCTGAGCCTTCCAATGGGTCTTCAGTTTCCTCAAGCC
AGGAGCGGGACGCACCTCTGTCACCTAATGTGCAATCTAAATCAAAAAGATTGCCGCTAACAGCTAGGGAGAGACTGAGG
GCAGCCAAGGTTCTCAGGCGTTATAACACTGAAACAAAGCCAACTAAAAAATCAGAGAGGGGCAAGAATGTATTAGATGC
TCTCAGAGACAGTGAACGTGGGAAGAAAAGATCCGGACTTCCAGAGGCCCCTACAAACATTTTTGACGACAGCAAGCGAG
GGATGCCAAAGCAGGGCCTAACTTGGGATTTTCCAGGGGGTGCTGATTTGTTTCTAATTATCTTCTCATTTGTATTTATC
AGCACGGTCATGTTTGCTACAACTTACGTTGTTTGGAAACTTGGTGCCATCCATTTCAATGAAAACTGA