Details for Peach Locus ppa011950m

Position : sca2 ( 5`- 20787508 .. 20786142 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa011950m

Protein [Map View]
MAARMLQRRIGSLFLSNQQQHAKLFKEQFVPSVSSVLGKYGFDKRDFQTQTNATNLVNEGLADHGDGSLKPNCDSNNSPS
LSNAISSSDVKFSAAANLKTSPRHDLAMLFTCKVCETRSMKTCSRESYESGVVVARCGGCDNLHLIADHLGYFGAPGTIE
DFLAARGEEVKKGSADTLNLTVEDLAGKKI*

DNA
ATGGCTGCTCGGATGTTGCAGAGGCGCATAGGCTCACTCTTCCTCAGCAATCAGCAGCAGCACGCCAAACTCTTCAAAGA
GCAATTTGTTCCTTCTGTGAGTTCTGTACTCGGGAAATATGGATTTGACAAAAGGGATTTTCAGACGCAAACAAATGCAA
CCAATCTAGTTAATGAGGGTTTGGCAGATCATGGAGATGGCAGTTTGAAGCCTAATTGTGACTCGAATAACTCTCCGTCC
CTCTCAAATGCCATCAGCAGTTCTGATGTCAAATTTTCTGCTGCTGCCAACTTGAAAACATCCCCAAGGCATGACCTTGC
CATGCTTTTTACTTGCAAGGTCTGTGAAACAAGATCTATGAAGACGTGTAGTCGAGAATCATACGAGAGTGGTGTGGTGG
TAGCGCGTTGTGGCGGGTGTGATAATCTACACCTGATTGCTGATCATCTTGGGTACTTTGGAGCACCGGGAACCATCGAG
GACTTTCTGGCTGCCCGCGGGGAGGAGGTGAAAAAAGGTTCTGCTGATACACTGAATCTGACTGTTGAAGATTTAGCCGG
AAAGAAAATTTGA