Details for Peach Locus ppa011690m

Position : sca2 ( 5`- 23400590 .. 23398772 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa011690m

Protein [Map View]
MRTLAARLTTYYCRRNPVRNSQPRNFSTYNGRDELSLEQDAERKIGWLLKLIFAGTATCIAYNIMPYMGDNLLQQSVSLL
TVKDPLFKRMGASRLAQFAIDDERRMKIVEMGGAQELVNMLVDAKDDRTRKEALKALSALSPSDQAIGALHQAGAISVIR
STPDSLESAEIEKYKSGLLKRFQDLRYDVPSTNVSRSSDS*

DNA
ATGCGTACGTTAGCAGCCAGGCTCACCACTTATTACTGTAGAAGAAACCCAGTACGGAATTCGCAGCCTCGCAATTTCTC
CACTTACAACGGAAGAGATGAGCTCTCCCTTGAACAGGACGCTGAAAGAAAAATCGGATGGCTGTTGAAGCTGATATTTG
CTGGGACTGCTACTTGCATAGCTTACAACATCATGCCGTATATGGGAGATAATTTGTTGCAACAGTCCGTGTCACTTTTA
ACAGTCAAGGATCCTTTGTTCAAGAGAATGGGGGCTTCTCGATTAGCTCAGTTTGCGATTGATGATGAAAGGAGGATGAA
AATAGTGGAGATGGGTGGTGCTCAAGAGCTCGTAAACATGTTGGTGGATGCTAAAGATGACCGCACAAGGAAGGAGGCTT
TGAAAGCTCTTTCTGCTCTGTCACCCTCAGATCAAGCTATTGGAGCTTTACACCAAGCTGGGGCAATCTCAGTTATCAGA
TCAACCCCTGATTCCTTGGAGAGTGCTGAAATTGAGAAATACAAGTCAGGCTTGCTCAAGAGATTTCAAGATCTTAGATA
CGATGTTCCGTCTACAAATGTGTCAAGGTCTTCAGACTCTTAG