Details for Peach Locus ppa011389m

Position : sca2 ( 5`- 23341072 .. 23340434 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa011389m

Protein [Map View]
MASPPTLPISNNQSTVGAQSQPPIATPAFRAFLSRFSSSIRYGFSQRRPWYELLDRSSLARPDSLSDAYSRIRKNFTYFR
VNYVSLLALVLALSLLTHPFSLLVLLSLLGAWAFLYLFRPSDQPLVIVGRTFSDAETLVGLVVLTVVVVFVSSVGSLLIS
ALLIGFAIVCAHGAFRVPEDLFLDDQEPANAGFLSFLGGATSTAAASVAARV*

DNA
ATGGCCAGCCCACCGACACTCCCGATCTCCAACAACCAATCGACCGTCGGCGCCCAGTCACAGCCTCCGATCGCCACGCC
CGCCTTCCGCGCGTTCCTCTCACGCTTCTCCTCGTCGATCCGCTACGGCTTCTCGCAGCGCCGGCCCTGGTACGAGCTCC
TAGACCGGAGCTCCTTGGCCCGACCCGACTCCCTCTCCGACGCCTACTCTCGGATCCGCAAGAATTTCACCTACTTCCGC
GTCAACTACGTGTCCCTGCTCGCCCTCGTACTCGCCCTCTCTCTCCTCACCCACCCCTTCTCTCTCCTCGTCCTACTCTC
GCTCCTCGGCGCGTGGGCCTTCCTCTACCTATTTAGACCCTCCGATCAGCCCCTGGTCATCGTAGGCCGCACTTTCTCTG
ACGCCGAAACACTTGTCGGCCTCGTCGTGTTGACTGTGGTCGTGGTCTTCGTCTCCAGCGTCGGCTCGCTCCTCATCTCA
GCTTTGTTGATCGGCTTCGCCATTGTTTGTGCGCACGGTGCGTTTAGGGTTCCAGAGGACCTATTCCTTGACGACCAGGA
GCCGGCCAACGCTGGCTTCCTCTCATTCCTCGGCGGCGCCACCTCAACCGCTGCCGCCTCCGTCGCAGCACGTGTGTAG