Details for Peach Locus ppa011387m

Position : sca1 ( 5`- 27349763 .. 27350994 -3` )
Annotation : [B2G] transmembrane emp24 domain-containing protein 10
External links : CoGe
PGDD synteny : ppa011387m

Protein [Map View]
MAGLRLLVAAVILGFLSSTSESLRFELQSGHTKCIVEDIKANAMTVGKYSVVNPNEGHPIPDSHKLTVRVTSHYGNNYHY
SELVESGQFAFVAAEAGDYMACFWAPDHKPQITLTIEFDWKTGVAAKDWSNVAKKGTVDVMELELKKLFETVTSIHEEMF
YLRQREEEMQELNRTTNSRMAWFSLLSLFVCSSVAALQWWHLKTFFEKKKLI*

DNA
ATGGCTGGGTTGCGTCTGCTTGTTGCTGCTGTAATCCTAGGGTTTCTATCGTCTACATCGGAATCTCTGCGGTTCGAGCT
GCAATCGGGCCACACCAAATGCATCGTGGAAGACATAAAAGCCAATGCCATGACGGTCGGCAAGTACAGCGTCGTCAACC
CTAACGAAGGCCACCCCATTCCCGATTCTCACAAGCTCACCGTCAGGGTGACGTCGCACTATGGGAATAACTATCATTAC
TCGGAGCTGGTGGAATCGGGGCAGTTCGCATTTGTGGCGGCGGAGGCGGGAGATTACATGGCCTGCTTCTGGGCGCCTGA
TCACAAGCCCCAAATTACGTTGACCATTGAATTCGATTGGAAGACCGGCGTCGCCGCTAAAGACTGGTCCAATGTGGCCA
AGAAAGGCACTGTCGATGTTATGGAATTAGAGCTTAAAAAGTTGTTTGAAACTGTTACTTCCATTCATGAGGAAATGTTC
TATCTCCGTCAAAGGGAAGAAGAAATGCAGGAGCTTAACAGAACAACTAACTCCAGAATGGCCTGGTTTAGTTTGCTCTC
GCTTTTTGTTTGCTCATCGGTTGCAGCTTTGCAATGGTGGCACTTGAAGACCTTTTTTGAGAAAAAGAAGCTCATCTAA