Details for Peach Locus ppa011276m

Position : sca2 ( 5`- 21650488 .. 21649388 -3` )
Annotation : [B2G] chalcone isomerase
External links : CoGe
PGDD synteny : ppa011276m

Protein [Map View]
MAALPNLTGLQIEATSFPPSVKPPGSANTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDKAVPLLAVKWKGKTAQELTESV
EFLREIVTGPFEKFTQVTTILPLTGQQYSEKVSENCVAIWKSIGIYTDAEAKAIEKFLEVFKDQNFPPGASILFTQSPNG
SLTISFSKDASVPEAGNVVIENKLLSEAVLESIIGKHGVSPGARQSVAARLSELLK*

DNA
ATGGCTGCACTACCAAATCTCACCGGACTTCAGATCGAGGCGACGTCGTTTCCACCGTCAGTCAAACCCCCCGGCTCCGC
CAACACTCTGTTCCTCGGCGGCGCAGGGGTGAGGGGGCTGGAGATTCAGGGGAACTTCGTGAAGTTCACGGCGATTGGCG
TGTACTTGGAGGATAAGGCCGTGCCTCTGCTTGCCGTTAAGTGGAAAGGCAAGACCGCCCAGGAGCTGACGGAGTCCGTT
GAGTTCCTCAGAGAGATCGTTACAGGTCCATTTGAGAAATTCACACAGGTGACAACGATACTGCCACTAACCGGCCAGCA
ATACTCAGAGAAGGTTTCGGAGAATTGCGTTGCGATTTGGAAATCAATCGGAATTTACACTGATGCAGAAGCCAAGGCCA
TTGAGAAGTTCCTTGAGGTCTTCAAGGATCAAAACTTCCCACCTGGCGCCTCTATCCTTTTCACACAATCTCCCAATGGA
TCATTAACGATAAGCTTCTCCAAAGATGCATCCGTACCAGAAGCTGGGAACGTGGTGATCGAAAATAAACTGCTTTCGGA
GGCAGTTCTAGAGTCGATCATAGGAAAGCACGGCGTTTCTCCTGGAGCAAGGCAGAGTGTAGCTGCGAGGTTATCTGAAT
TGTTGAAGTAG