Details for Peach Locus ppa011182m

Position : sca3 ( 5`- 19492048 .. 19494454 -3` )
Annotation : [B2G] vesicle transport v-snare protein
External links : CoGe
PGDD synteny : ppa011182m

Protein [Map View]
MSDVFEGYERQYSELSANLTKKCTVAGALDGEQKKQKISEIKAAIDDAESLIRKMDLEARSLPPNIKAVLLAKLREYKSD
LNNLKSEVKRLVSGNSYSSARDELLESGMADTLTASADQRGRLMMSTERLNKSSDRVKDSRRTMLETEELGVSILQDLHS
QRQSLLHANNTLHGVDDNIGKSKRVLTSMARRMSRNKWIIGSVIAVLVIAIALILYFKLK*

DNA
ATGAGTGACGTATTTGAAGGGTACGAGCGCCAATACAGTGAGCTCTCTGCCAACCTCACCAAAAAGTGTACGGTAGCTGG
TGCTCTTGATGGAGAGCAAAAGAAGCAAAAGATTTCTGAAATAAAGGCTGCAATTGATGATGCAGAATCTTTGATCCGGA
AAATGGACCTCGAGGCAAGAAGTTTGCCACCAAATATTAAAGCTGTGCTTCTTGCTAAGTTGAGGGAATATAAATCAGAT
CTGAATAATCTGAAAAGCGAAGTTAAAAGACTTGTATCTGGTAACTCATATTCATCTGCCCGAGATGAGTTGTTGGAATC
AGGCATGGCTGATACTCTGACGGCATCAGCTGATCAAAGAGGAAGGCTAATGATGTCAACAGAGAGATTAAACAAGTCTA
GTGATAGAGTTAAGGACAGTAGAAGAACCATGCTGGAAACAGAAGAGCTTGGTGTTTCAATCCTTCAAGATCTGCATTCA
CAGAGACAGTCTCTGTTACATGCAAATAACACGCTTCATGGGGTGGATGACAACATAGGGAAAAGCAAGAGAGTTTTGAC
TTCCATGGCACGGAGGATGAGCAGGAACAAGTGGATTATTGGCAGTGTTATTGCCGTTCTTGTCATTGCCATCGCCTTGA
TCTTGTACTTCAAACTTAAATAG