Details for Peach Locus ppa011102m

Position : sca1 ( 5`- 27368130 .. 27366273 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa011102m

Protein [Map View]
MSEVFEGYERQYCELSANLSRKSNSAALLPDHEQKKQRFSEIKVGLDDADALIRKMDLEARSLQPSVKAVLLAKLREYKS
DLNNLKREIKRITSPDANQAAREELLESGMADAHAVSSDQRERMTMSVERLNQSSDRITESRRTILETEELGVSILQDLH
QQRETLLHSHQKLHGVDDAIDKSKRVLTAMSRRMTKHKWIIGSVIGALIVAILFILYFKFSHH*

DNA
ATGAGTGAGGTGTTCGAAGGCTACGAGCGTCAGTACTGCGAGCTCTCCGCAAATCTCTCACGAAAATCTAACTCCGCCGC
CCTTCTTCCTGACCATGAGCAGAAGAAGCAGAGGTTTTCTGAGATTAAAGTTGGCTTGGACGATGCTGATGCTTTGATTC
GGAAAATGGACCTTGAAGCCAGAAGCTTGCAGCCGAGTGTAAAGGCGGTGCTTCTTGCTAAGCTAAGGGAATATAAATCC
GATCTCAATAACTTGAAAAGGGAAATCAAAAGAATTACATCACCTGATGCTAATCAGGCTGCTCGTGAAGAGCTGTTGGA
GTCCGGGATGGCTGATGCCCATGCGGTTTCTTCTGATCAAAGAGAGAGAATGACAATGTCTGTTGAGAGATTAAATCAAT
CAAGTGATAGAATCACGGAGAGTAGGAGAACCATACTAGAGACTGAAGAGCTTGGTGTCTCCATTCTCCAAGATTTGCAT
CAACAACGGGAAACTCTCCTGCATTCCCATCAAAAACTTCATGGGGTAGATGACGCCATTGACAAGAGTAAAAGAGTTTT
AACTGCCATGTCACGGAGGATGACCAAGCATAAATGGATCATCGGCTCAGTCATCGGAGCTCTTATTGTTGCAATCCTGT
TTATTCTATATTTTAAGTTTTCTCATCATTAA