Details for Peach Locus ppa010997m

Position : sca2 ( 5`- 22166801 .. 22166115 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa010997m

Protein [Map View]
MGEKEKKTSNKNKKQKHQHPNDQTTKTASSDFSFKPSSEVKGLRFGGQFIVKSFTIRRARPLELLQLLSLPPPNKPNSNN
KLPFPSTTAFLPTNFTILAHHAWHTLTLGLGTKKSKVVLFVFETEAMKAAVDRVWPPEIPLGEVNKRLIRGLNGCEIARF
KFRKGCITFYVYAVRQVGSLGFSSADDLRTILQSVVALQDFLDHTAMLAMPNQRTISYANVAPVAMAH*

DNA
ATGGGAGAGAAAGAGAAGAAGACCAGTAACAAGAACAAGAAGCAGAAACACCAGCACCCAAATGATCAAACCACAAAAAC
AGCCTCATCAGATTTCTCATTCAAGCCAAGCTCTGAGGTGAAGGGTCTGCGTTTTGGAGGCCAGTTCATTGTAAAATCAT
TCACAATCAGGCGTGCAAGGCCTTTAGAGCTTCTGCAACTCCTCTCACTTCCACCACCAAACAAACCCAACTCCAACAAT
AAGCTTCCTTTTCCTTCAACCACAGCTTTTCTTCCCACAAACTTCACAATCTTGGCACACCATGCCTGGCACACCCTCAC
ATTAGGCCTTGGCACCAAGAAATCCAAAGTGGTTCTGTTTGTTTTCGAAACCGAAGCCATGAAGGCTGCCGTAGACCGCG
TTTGGCCACCAGAAATTCCTCTTGGGGAAGTGAACAAGAGGCTCATCAGAGGCCTGAATGGCTGTGAGATAGCAAGGTTC
AAATTCAGAAAAGGATGCATAACTTTTTATGTGTATGCTGTTAGACAAGTGGGAAGCTTGGGTTTCTCAAGTGCTGATGA
TCTCAGAACAATTCTGCAGTCTGTTGTGGCGCTTCAAGATTTCTTGGATCACACTGCAATGCTTGCCATGCCCAACCAGA
GAACCATTAGCTATGCAAATGTAGCTCCTGTGGCCATGGCTCACTAG