Details for Peach Locus ppa010748m

Position : sca2 ( 5`- 23528174 .. 23530666 -3` )
Annotation : [B2G] manganese superoxide dismutase
External links : CoGe
PGDD synteny : ppa010748m

Protein [Map View]
MALRSLVARKSLGLGFQSKAKILAVGSTAHSRGFQTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYVTNYNKALEQL
HDAIAKGDAAAVVKLQSAIKFNGGGHVNHSIFWKNLTPVGQGGGEPPHGSLGWAIDTNFGSMEALVQKINAEGAALQGSG
WVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKESP*

DNA
ATGGCTCTTCGATCTCTCGTGGCCAGGAAATCCCTTGGATTGGGGTTTCAGAGCAAAGCCAAAATCCTCGCCGTAGGTTC
TACAGCTCATTCCCGTGGCTTTCAAACCTTCTCGCTTCCCGACCTTCCGTACGACTATGGCGCTCTCGAGCCTGCAATTA
GTGGCGAGATCATGCAGCTCCATCACCAGAAGCACCACCAGACTTACGTCACCAACTACAACAAAGCTCTTGAGCAGCTC
CACGACGCCATCGCCAAGGGTGATGCTGCTGCTGTTGTTAAATTGCAGAGCGCCATCAAGTTCAATGGCGGAGGTCATGT
CAACCACTCGATTTTCTGGAAGAATCTTACTCCTGTTGGTCAAGGAGGTGGTGAGCCCCCTCATGGTTCCCTGGGCTGGG
CTATTGACACAAATTTTGGTTCTATGGAAGCATTAGTGCAAAAGATCAATGCAGAAGGCGCTGCTTTGCAGGGTTCTGGA
TGGGTGTGGCTGGCTCTAGACAAAGAGTTGAAGAAACTTGTGGTTGAAACCACTGCAAATCAGGACCCATTGGTTACCAA
AGGACCAACTTTAGTTCCATTGCTTGGTATTGATGTTTGGGAGCATGCGTACTACTTACAGTATAAGAATGTGAGGCCAG
ATTATCTCAAGAACATATGGAAAGTAATCAACTGGAAGTATGCCAGCGAAGTGTACGAGAAAGAAAGCCCTTGA