Details for Peach Locus ppa010525m

Position : sca2 ( 5`- 22303363 .. 22305874 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa010525m

Protein [Map View]
MWIGLVAQTLPNAHGHRSSRLYDPIYRLPFNPTTRLPCSVSEAAIFPRNGPLKIASVVAMSDAIDLSGDGGVLKKIVRHA
KPDAIAPTQDLPLVDVHYEGILEETNEVFDTTHEDNTVFSFELGKGSVIKAWDIAVKTMKVGEIAKITCKPEYAYGSAGS
PPDIPPEATLIFEVELVACNPRKGLSLGSASEERARLEELKKQREMAAANKEEEKKKREEAKAAAAARIQAKLDAKKGGK
GKGKGK*

DNA
ATGTGGATTGGTTTAGTTGCACAAACTTTACCAAACGCCCATGGCCACCGAAGCTCCCGGCTATACGACCCGATTTATCG
TCTCCCTTTCAACCCGACAACCCGATTGCCCTGCTCCGTTTCGGAAGCTGCTATATTCCCTCGGAACGGACCATTGAAGA
TTGCAAGTGTTGTAGCAATGAGTGATGCAATTGATTTGAGCGGGGATGGAGGGGTCCTCAAGAAAATTGTAAGGCATGCA
AAACCAGATGCAATTGCTCCGACCCAAGACCTTCCCCTCGTTGATGTTCATTATGAAGGCATTCTTGAGGAAACCAACGA
AGTTTTTGATACGACACATGAAGATAACACGGTTTTCTCATTTGAGCTGGGGAAGGGCAGTGTAATCAAGGCTTGGGATA
TTGCAGTGAAAACCATGAAGGTTGGGGAGATTGCTAAAATCACTTGCAAGCCAGAATATGCCTATGGAAGTGCGGGTTCT
CCACCAGATATTCCACCAGAGGCAACCCTTATATTTGAGGTGGAGTTGGTGGCTTGCAATCCACGGAAGGGATTAAGTTT
GGGTAGTGCCTCAGAAGAAAGGGCCAGGCTAGAAGAACTGAAGAAGCAGAGGGAGATGGCTGCTGCAAACAAAGAGGAAG
AGAAGAAGAAGAGAGAAGAGGCGAAAGCTGCTGCTGCTGCTCGTATTCAAGCTAAGTTAGATGCCAAGAAGGGTGGAAAG
GGAAAAGGCAAAGGAAAATAG