Details for Peach Locus ppa010341m

Position : sca2 ( 5`- 22461902 .. 22463312 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa010341m

Protein [Map View]
MAFTSILRRSASSLAPLASRLARGNRSYHGALVNAINHVNHSYKSTLTPFVPTPRYYSSHSSDQSLLKVIDAEIKCAEET
DDLDKAEEIPSGFPFQIEDTPGAQIVTLKRTYQGENIVVEVHMPDLVTGDEENDGDQDGDDEDGSANKSSLPLLVTVSKS
DGPSLEFSCTAFADEIEIDSLAVKNPENSEDQIAYEGPDFHDLDENLQKAFHKYLEIRGIKPSTTNFLHEYMINKDTREY
ANWLQKLKQFVAA*

DNA
ATGGCTTTCACTTCAATTCTTCGCAGATCGGCCTCCTCTTTGGCTCCATTGGCCAGCCGACTGGCTCGGGGCAATCGATC
TTACCATGGTGCTCTCGTCAACGCCATAAACCACGTCAATCACTCCTACAAGTCCACTCTGACCCCTTTTGTTCCGACCC
CTCGCTATTATTCCAGCCACAGTTCGGACCAGTCTCTTCTCAAGGTTATCGATGCAGAGATAAAGTGCGCTGAGGAGACC
GATGATCTTGACAAGGCTGAAGAGATTCCAAGTGGCTTCCCTTTTCAAATTGAAGATACTCCCGGAGCCCAAATAGTGAC
ACTGAAAAGAACATATCAGGGTGAAAACATAGTAGTTGAAGTTCACATGCCTGATCTAGTTACTGGTGATGAAGAAAATG
ACGGTGACCAGGATGGTGATGATGAGGATGGAAGTGCTAATAAGTCCAGCCTCCCGTTGCTCGTAACTGTCTCCAAGAGT
GATGGACCTTCTCTTGAGTTCAGCTGCACTGCTTTTGCTGATGAGATTGAAATTGACAGCTTGGCAGTGAAAAATCCAGA
GAATTCGGAGGATCAGATTGCCTATGAGGGGCCTGACTTCCATGATTTGGATGAGAACCTTCAGAAGGCATTCCACAAGT
ATTTGGAGATTAGAGGAATCAAGCCCAGCACAACCAATTTCTTGCATGAGTACATGATCAACAAAGACACTAGAGAATAT
GCGAATTGGTTGCAGAAACTTAAGCAGTTCGTTGCAGCTTAA