Details for Peach Locus ppa010323m

Position : sca2 ( 5`- 22195388 .. 22198459 -3` )
Annotation : [B2G] unknown [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa010323m

Protein [Map View]
MGRKFFVGGNWKCNGTFDEVKKIVKILNEGQVPSQDVVEVVVSPPYVFLPVVKSSLRPDFHVAAQNCWVKKGGAFTGEVS
AEMLVNLEVPWVILGHSERRLILGESNEFVADKVAYALAQGLKVIACVGETLEQRESGSTVEVVAAQTKAIAAKVSDWTN
VVLAYEPVWAIGTGKVASPAQAQEVHFELRKWLQANVSPEVAATTRIIYGGSVNGANSKELAGQPDVDGFLVGGASLKPE
FIDIIKSAEVKKSA*

DNA
ATGGGCAGGAAGTTCTTCGTCGGCGGCAACTGGAAATGCAATGGAACCTTCGATGAGGTGAAGAAGATTGTGAAGATACT
CAATGAGGGACAAGTGCCATCACAAGATGTTGTGGAGGTTGTGGTGAGCCCACCATATGTGTTTCTTCCAGTGGTGAAGA
GTTCGTTGAGGCCTGACTTTCATGTTGCGGCTCAAAACTGCTGGGTCAAGAAGGGTGGTGCCTTCACTGGTGAAGTTAGT
GCTGAAATGCTGGTCAATCTGGAGGTTCCTTGGGTCATTCTTGGTCATTCTGAGAGAAGACTTATTTTAGGCGAATCCAA
TGAGTTTGTTGCCGATAAGGTTGCATATGCACTAGCTCAAGGTTTGAAGGTGATTGCTTGTGTTGGTGAGACTCTTGAGC
AGCGAGAATCTGGCTCGACCGTGGAGGTTGTGGCTGCACAAACCAAGGCCATTGCAGCAAAAGTGTCAGATTGGACCAAT
GTTGTGTTGGCCTATGAGCCCGTGTGGGCCATTGGAACTGGCAAAGTTGCATCTCCAGCTCAGGCTCAGGAAGTGCATTT
TGAATTGAGGAAATGGCTTCAAGCAAACGTAAGTCCTGAAGTTGCTGCAACAACCAGGATCATTTATGGAGGGTCTGTCA
ATGGTGCAAACAGCAAAGAGCTGGCAGGTCAGCCCGATGTTGACGGATTTTTGGTTGGTGGAGCTTCTCTAAAGCCTGAG
TTTATTGACATTATCAAGTCTGCGGAGGTGAAGAAAAGTGCCTAA