Details for Peach Locus ppa010045m

Position : sca2 ( 5`- 21333034 .. 21335353 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa010045m

Protein [Map View]
MDDYTREMMDLKTLVTRTLEKKGVLAKIRAELRASVFEAIEEEDKVIEKEEGLPPALLGSCNDRAKQLHASPSGRLLTAL
VCEYLDWAQLNHTLKVYQPECNLQKDSWKAELKDFSSKNGYDLNRNGDSGPLLLDVLEGFLKFENLSQARGTGRRLATSE
TESLSNLDSRNMRRPSSSSVAGGLPPLGRPGASSQSSDRRGGSSMSSYRKDDYNWRYDSDESPEDVIRASSAMENLQLDR
KARNLTTSWRHAGDGISEDEGRSDQM*

DNA
ATGGACGACTACACGAGGGAGATGATGGACCTCAAGACTCTGGTCACTCGCACCCTTGAGAAGAAGGGCGTTCTGGCCAA
GATCCGGGCTGAGTTGAGAGCAAGTGTGTTTGAGGCAATTGAAGAGGAGGACAAGGTCATCGAGAAAGAAGAAGGCTTGC
CTCCGGCATTGCTTGGTAGCTGCAACGATCGTGCTAAACAGCTCCATGCTTCCCCTTCAGGAAGGTTGCTTACAGCACTA
GTATGCGAATACTTAGACTGGGCGCAACTAAACCATACGCTAAAAGTGTATCAGCCTGAGTGTAATTTGCAAAAGGATTC
TTGGAAAGCTGAGTTGAAGGACTTTAGTAGCAAGAATGGATATGATCTTAACCGAAATGGGGATAGTGGTCCTTTGCTTT
TGGACGTGCTTGAAGGATTTTTGAAATTTGAGAATTTATCTCAAGCAAGGGGTACTGGAAGGAGGCTAGCTACTTCAGAA
ACAGAGTCCTTATCCAATTTAGACTCTCGCAACATGCGAAGACCTTCTTCATCATCTGTTGCTGGAGGGCTGCCTCCACT
AGGAAGGCCTGGTGCGTCTTCCCAGTCATCTGATCGAAGAGGTGGGTCGTCCATGTCTAGCTACAGGAAAGATGACTACA
ATTGGAGATATGATAGTGATGAAAGTCCAGAGGATGTCATTCGAGCTTCAAGTGCCATGGAAAACCTTCAATTGGATAGA
AAAGCTCGCAATCTAACCACATCGTGGCGGCATGCAGGCGATGGAATTAGCGAGGATGAGGGCAGGTCTGATCAGATGTA
G