Details for Peach Locus ppa009804m

Position : sca2 ( 5`- 22309057 .. 22306504 -3` )
Annotation : [B2G] e3 ubiquitin-protein ligase sdir1-like
External links : CoGe
PGDD synteny : ppa009804m

Protein [Map View]
MSFVFRGTRADIESGFPEFIPERRAMRVHASRSVNSNSLAFLVTVLLLFMILNSHQMSPNFLLWLVLGVFLMATTLRMYA
TCQQLQAQAQAHAAAASGLLGHTELRLHVPPSIALATRGRLQGLRLQLALLDREFDDLDYETLRALDSDNVPAASSMSEE
EINALPVHKYKVMGLQTGASSIQQASSSVPSEKKQETANTVGSTKASEDELTCSVCLEQVNVGELIRSLPCMHQFHASCI
DPWLRQQGTCPVCKFRAGSVAWHENSQGGMDPSYMV*

DNA
ATGAGTTTTGTTTTCCGGGGGACAAGAGCAGATATTGAAAGTGGATTCCCGGAATTTATACCAGAGCGGCGTGCAATGCG
CGTTCATGCATCACGTTCTGTCAATTCCAACTCACTTGCTTTTCTTGTCACAGTTCTTTTGTTATTCATGATACTGAACT
CGCACCAGATGTCACCTAATTTCCTGCTCTGGCTAGTTCTTGGCGTCTTTTTGATGGCCACAACGTTAAGGATGTACGCA
ACCTGTCAACAACTTCAAGCTCAAGCACAGGCTCATGCAGCGGCAGCCAGCGGCCTTCTTGGTCATACTGAATTGCGGTT
GCATGTGCCACCATCCATAGCCCTAGCAACAAGAGGGCGCCTTCAAGGCCTCAGACTTCAGCTTGCACTTCTTGATCGGG
AATTTGATGACCTAGATTATGAAACTTTGCGAGCTTTGGATTCTGATAATGTTCCAGCAGCTTCTTCTATGAGTGAGGAA
GAGATAAATGCTCTTCCAGTCCATAAATACAAGGTTATGGGTCTTCAGACTGGTGCTTCATCGATTCAACAAGCTTCATC
TTCAGTACCCTCTGAGAAGAAGCAAGAAACTGCTAACACAGTTGGGAGCACAAAAGCCTCAGAAGATGAACTGACTTGCA
GTGTTTGCTTGGAGCAAGTTAACGTGGGAGAACTAATCCGCAGCCTTCCTTGCATGCATCAGTTCCATGCTAGTTGCATA
GATCCTTGGCTGAGGCAACAGGGAACCTGCCCAGTGTGTAAATTCAGAGCAGGATCGGTGGCGTGGCATGAAAATAGCCA
AGGTGGAATGGATCCTTCGTACATGGTTTGA