Details for Peach Locus ppa009703m

Position : sca2 ( 5`- 23235851 .. 23233543 -3` )
Annotation : [B2G] chloroplast ferritin
External links : CoGe
PGDD synteny : ppa009703m

Protein [Map View]
MLLKGSPASSHLITRGENLGPLFSSAPSLSSSKLSYSFSPLNSFTSLNSILRFPPTRNEGGVVVCASKNANNRPLTGVVF
EPFEEVKKELELVPTLPQVSLARQKFTNESEAAINEQINVEYNVSYVYHAMYAYFDRDNVALKGLAKFFKESSEEERDHA
EKLMEYQNKRGGRVKLQSILMPVSEFDHAEKGDALYAMELALSLEKLTNEKLLNLHHVAEKNKDVQLTDFVESEFLTEQV
EAIKKISEYVAQLRRVGKGHGVWHFDQALLHGDGAVDAIAA*

DNA
ATGCTTCTCAAAGGTTCTCCAGCCTCCTCTCACTTGATCACTCGCGGGGAGAACTTGGGTCCTCTGTTTTCCTCTGCTCC
ATCTTTATCTTCGTCCAAGCTTTCGTATTCGTTCTCTCCTCTGAACTCGTTCACATCTCTGAATTCGATTCTTCGGTTCC
CTCCGACGAGAAATGAAGGTGGGGTTGTGGTCTGTGCGTCCAAGAATGCGAATAATCGGCCACTTACCGGTGTGGTTTTC
GAGCCATTTGAAGAGGTGAAGAAGGAGCTAGAACTCGTACCTACTCTTCCACAAGTCTCTCTTGCTCGCCAGAAGTTTAC
CAATGAAAGCGAGGCAGCTATTAACGAACAGATCAATGTGGAATACAACGTCTCCTACGTTTACCATGCCATGTATGCCT
ATTTCGACAGGGACAATGTAGCGCTCAAGGGTCTTGCCAAGTTTTTCAAGGAATCGAGTGAGGAAGAGAGGGACCATGCT
GAGAAGCTTATGGAATACCAGAATAAACGCGGTGGAAGAGTGAAATTGCAGTCTATTTTGATGCCTGTTTCTGAGTTTGA
TCATGCAGAGAAAGGAGATGCTTTATATGCAATGGAGCTTGCATTGTCTCTGGAGAAACTGACAAATGAAAAGCTGCTCA
ACTTACACCATGTTGCTGAGAAGAACAAAGATGTGCAGTTAACAGATTTCGTTGAAAGCGAGTTTTTGACTGAGCAGGTG
GAAGCCATCAAGAAAATATCTGAATATGTTGCTCAACTAAGGAGAGTCGGGAAAGGACATGGGGTTTGGCACTTCGATCA
GGCACTGCTTCATGGGGATGGAGCCGTTGATGCAATTGCTGCGTGA