Details for Peach Locus ppa009592m

Position : sca2 ( 5`- 22510018 .. 22507849 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa009592m

Protein [Map View]
MQTEARVGVVVEGGQRALNTGHGGVAVEGGVRTLAQSLPQKQPKPLHQQSQIGTVSQLLAGGVAGALSKTCTAPLARLTI
LFQVQGMHSDVATLRKASIWREASRIAGEEGFRAFWKGNLVTIAHRLPYSSVNFYAYEHYKKFLQTMPGLENHRENLSTD
LCVHFVGGGLAGITAASATYPLDLVRTRLAAQTNVMYYKGIWQTLRTISRDEGLFGLYKGLGATLLGVGPSIAISFSVYE
TLRASWQSHRPNDSTVLVSLACGSLSGIASSTEKTGCGAGSAPSL*

DNA
ATGCAGACGGAGGCGAGGGTTGGGGTGGTGGTGGAAGGAGGACAGAGAGCTCTGAATACTGGGCATGGAGGCGTGGCGGT
CGAAGGCGGTGTGAGAACACTGGCGCAGTCCCTGCCACAGAAACAGCCGAAGCCTCTGCACCAACAGTCTCAGATTGGAA
CGGTGTCGCAGCTTCTCGCCGGAGGTGTTGCCGGAGCTCTTAGTAAAACTTGTACGGCGCCTCTTGCTCGCCTTACCATT
CTTTTTCAGGTGCAAGGAATGCACTCAGATGTTGCAACATTGAGAAAGGCTAGCATATGGCGTGAGGCCTCAAGGATTGC
TGGTGAAGAAGGATTTAGAGCTTTCTGGAAAGGAAATCTGGTTACAATTGCTCATCGTCTTCCTTATTCTTCTGTCAATT
TCTATGCATACGAACATTATAAAAAGTTCCTACAAACAATGCCAGGACTGGAAAATCATAGGGAGAACTTGAGTACAGAC
CTTTGCGTACATTTTGTGGGTGGTGGATTGGCGGGAATAACAGCTGCATCAGCTACATATCCTTTGGATCTTGTAAGGAC
GCGCCTTGCAGCTCAGACAAATGTGATGTACTACAAAGGTATTTGGCAAACTTTGCGAACTATTAGTCGAGATGAGGGTC
TTTTTGGCCTCTATAAGGGACTTGGAGCAACCCTCTTGGGTGTCGGGCCCAGTATAGCTATCAGTTTTTCCGTGTATGAG
ACCTTGAGAGCTTCTTGGCAGTCACATAGGCCCAATGATTCTACTGTGTTGGTTAGTCTTGCTTGTGGGAGCCTTTCAGG
AATTGCGTCATCAACAGAGAAAACAGGATGTGGTGCAGGCTCTGCACCAAGTCTCTAA