Details for Peach Locus ppa009474m

Position : sca2 ( 5`- 23345055 .. 23348605 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa009474m

Protein [Map View]
MESSAVFRSFNCSVGTVSHVRSSLDKPGMLPAYNTARPTVSRSYFQGLMVSEKFIYSPQKRRGVQVSCVKTSEAAKSEKS
SDSKPQVSSERTTQPATFPNGFEALMLEVCDETEVAELKLKVGDFEMHLKRNIGATSAPVSSISPAAAPPIPSKPMVESA
PAPPPAPAPAPKSSSEKATPFTNTSVDKSSRLAALEASGANGYVLVSSPTVGSFRRGRTVKGKKQPPICKEGDLIKGGQV
IGYVDQFGTELPVKSDVGGEVLKLLFNDGEAVGYGDPLIAVLPSFHGININ*

DNA
ATGGAGTCCTCGGCTGTTTTCCGATCCTTTAACTGTTCTGTAGGCACAGTTTCTCATGTTCGGTCCTCGCTTGACAAGCC
TGGTATGCTTCCTGCGTATAATACCGCAAGGCCCACCGTGAGTAGATCATACTTCCAAGGCTTGATGGTTAGTGAGAAGT
TCATTTATTCTCCACAAAAGCGGAGGGGAGTGCAAGTATCATGTGTGAAGACATCTGAAGCTGCCAAGAGTGAAAAATCC
AGCGATAGTAAGCCACAAGTCTCATCAGAGAGAACTACTCAACCCGCAACTTTTCCTAATGGATTTGAGGCACTAATGCT
AGAAGTCTGTGATGAGACAGAAGTTGCTGAACTGAAACTTAAGGTTGGAGACTTTGAAATGCATTTGAAGCGTAATATTG
GAGCCACCAGTGCTCCTGTGTCTAGCATCTCGCCAGCAGCAGCACCACCTATTCCAAGTAAACCCATGGTTGAATCAGCT
CCTGCTCCCCCTCCAGCACCAGCACCAGCACCAAAATCTTCTTCTGAAAAAGCCACTCCATTTACCAACACTTCTGTAGA
CAAGTCATCAAGATTAGCAGCCTTGGAGGCTTCTGGAGCTAACGGATATGTTCTGGTTTCTTCTCCTACGGTTGGTTCAT
TCCGAAGGGGTAGAACAGTGAAAGGAAAGAAGCAACCTCCAATCTGTAAAGAGGGTGATCTGATCAAAGGAGGACAAGTA
ATCGGATATGTGGATCAGTTTGGCACTGAACTTCCTGTGAAGTCAGATGTGGGCGGAGAAGTTTTGAAGCTCCTCTTCAA
TGACGGAGAAGCCGTTGGTTATGGAGACCCACTCATCGCTGTCTTGCCATCATTTCACGGTATCAATATCAATTGA